DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and glipr2

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001107504.1 Gene:glipr2 / 100135358 XenbaseID:XB-GENE-5758336 Length:441 Species:Xenopus tropicalis


Alignment Length:167 Identity:59/167 - (35%)
Similarity:92/167 - (55%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ADLQE---DHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSAGQNYGENLCM 81
            ||.:|   :.|..:|..|.:||:.||.|:.::::..:.:|:.|.|.:.|:||.:   ::|||:..
 Frog   114 ADSREFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHLLNLKNLKHSDT---SHGENIWA 175

  Fly    82 RSQTP------LQCVQDWYDEIADYDFEKPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVV 140
            :|..|      .:....||.|..:|:|.||.....|||||.:|||.:|::|:|.|...||...||
 Frog   176 KSGGPSITVTGQEVADSWYKEEKNYNFSKPGNKAKTGHFTQMVWKASKEVGVGLASSGKGMLIVV 240

  Fly   141 ARYYPPVNVN--GQFEENVLPPIKGE------GDENG 169
            |:|.|..|:.  |.:..||||  :|.      |||:|
 Frog   241 AQYNPSGNITNPGFYGRNVLP--RGSKVTDDGGDEDG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 47/136 (35%)
glipr2NP_001107504.1 SCP <3..69 CDD:294090
SCP_GAPR-1_like 118..249 CDD:240182 46/133 (35%)
SCP_GAPR-1_like 295..426 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0001021
OrthoInspector 1 1.000 - - otm48948
Panther 1 1.100 - - O PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.