DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31482 and XB5812873

DIOPT Version :9

Sequence 1:NP_731097.1 Gene:CG31482 / 40806 FlyBaseID:FBgn0051482 Length:195 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:194 Identity:48/194 - (24%)
Similarity:76/194 - (39%) Gaps:45/194 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VLALCLLVLVIADLQEDHLN---------EHNR--LREKHG------SPPLTLDDELTKGCEEY- 55
            :|.|||..|.....::|.:.         |.||  :.:||.      :||..  |.|....:.| 
 Frog    35 LLLLCLASLSKPTSEQDSVESFDEMSTDLESNRNFIVDKHNYYRSWVNPPAA--DMLKMHWDNYY 97

  Fly    56 ---AKVLANNEKLEHSSSAGQNY-----GENLCMRS---QTPLQCVQDWYDEIADYDFE--KPQF 107
               ||..|.....:||:.:.:.|     |||: |.|   .:....:..|::|..::::.  ..:.
 Frog    98 LAKAKEWALTCSFKHSNLSFRQYGGEFAGENI-MNSYFRHSWEYVINYWFNEHVNWEYAVGTTKE 161

  Fly   108 AMSTGHFTALVWKNAKKMGIGQAK--DKKGYYWVVARYYPPVNVNGQFEENVLPPIKGEGDENG 169
            ...|||||.::|.....:....||  .....|:.|..|||    .|..|:.|..|.     :||
 Frog   162 GAVTGHFTQIIWAPTHALACYVAKCYGTPYNYFYVCIYYP----TGNREDKVKTPY-----QNG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31482NP_731097.1 SCP_GAPR-1_like 21..149 CDD:240182 37/160 (23%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 33/138 (24%)
Crisp 219..269 CDD:400739
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.