DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and ALD5

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_010996.2 Gene:ALD5 / 856804 SGDID:S000000875 Length:520 Species:Saccharomyces cerevisiae


Alignment Length:212 Identity:40/212 - (18%)
Similarity:89/212 - (41%) Gaps:36/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EVQVKYQWNSPRLMILCEDGDINCALHYLVESL--HDPFACNAVATLFLQESILEEFVDRIRDRL 153
            :|.::....||.  |:..|.|::.|:..:...:  :....|.|.:.:::|:::.||.:.:::|..
Yeast   284 KVTLELGGKSPN--IVFADADLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLQKLKDYT 346

  Fly   154 EPL---------------STDISGHPV--YIMTLERIGHLQAKRIVGNPKTVPEN--ASPMLVYD 199
            |.|               ::|...|.:  |:...:..|   |:.:.|..:...:.  ..|.:..|
Yeast   347 ESLKVGDPFDEEVFQGAQTSDKQLHKILDYVDVAKSEG---ARLVTGGARHGSKGYFVKPTVFAD 408

  Fly   200 LSH--RYLAD---GPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLI 259
            :..  |.:.:   ||  ::|:..|.|:.|.:.: |.:.....:..|....:..|.::..|:....
Yeast   409 VKEDMRIVKEEVFGP--IVTVSKFSTVDEVIAM-ANDSQYGLAAGIHTNDINKAVDVSKRVKAGT 470

  Fly   260 FTINCYYVNLNEITLPF 276
            ..||.|. |.:: .:||
Yeast   471 VWINTYN-NFHQ-NVPF 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 39/206 (19%)
ALD5NP_010996.2 ALDH_F1-2_Ald2-like 41..513 CDD:143410 40/212 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.