DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and PUT2

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_011902.1 Gene:PUT2 / 856432 SGDID:S000001079 Length:575 Species:Saccharomyces cerevisiae


Alignment Length:156 Identity:39/156 - (25%)
Similarity:64/156 - (41%) Gaps:52/156 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VQVKYQWNSPRLMILCEDGDINCAL--------HYLVESLHDPF-----ACNAVATLFLQESILE 143
            |:.||: :.||  |:.|.|..|..|        |.::.::...|     .|:|.:.|:|.||..|
Yeast   304 VEGKYR-DYPR--IIGETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLPESKSE 365

  Fly   144 EFVDRIRDRLEPLSTDISGHPVYIMTLERIGHLQAKRIVGNPKTVPEN--ASPMLVYDLSHRYLA 206
            ||:.                       :..|.||::.:      ||.|  |||:...:| ..:: 
Yeast   366 EFLS-----------------------DMFGILQSQNV------VPMNTSASPISGGNL-RGFM- 399

  Fly   207 DGPTGVITLHTFRTMKEAVELQAKEP 232
             ||  ||...:|..:.:.:|...|:|
Yeast   400 -GP--VIHEQSFDKLVKVIEDAKKDP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 36/151 (24%)
PUT2NP_011902.1 D1pyr5carbox1 29..574 CDD:273517 39/156 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.