DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and ALD2

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_013893.1 Gene:ALD2 / 855206 SGDID:S000004780 Length:506 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:42/220 - (19%)
Similarity:89/220 - (40%) Gaps:45/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EVQVKYQWNSPRLMILCEDGDINCALHYLVESL--HDPFACNAVATLFLQESILEEFVDRIRD-- 151
            :|.::....||.|:.  ||.|::.|:.::...:  :....|.|.:.:::|.||.::||::.::  
Yeast   264 DVTLECGGKSPALVF--EDADLDKAIDWIAAGIFYNSGQNCTANSRVYVQSSIYDKFVEKFKETA 326

  Fly   152 --------RLEPLSTDISGHPVYIMTL--------------ERIGHLQAKRI-VGNPK--TVPEN 191
                    :.:|........||...|.              |::...|.... :|..|  .:|  
Yeast   327 KKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIERGKREEKLDMFQTSEFPIGGAKGYFIP-- 389

  Fly   192 ASPMLVYDL--SHRYLAD---GPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYEL 251
              |.:..|:  :.:.|.|   ||  |:.:..|....:|::| |.:.....:..::.:.:..|:..
Yeast   390 --PTIFTDVPQTSKLLQDEIFGP--VVVVSKFTNYDDALKL-ANDTCYGLASAVFTKDVKKAHMF 449

  Fly   252 VARLSPLIFTINCYYVNLNEITLPF 276
            ...:......||.  .|..::|:||
Yeast   450 ARDIKAGTVWINS--SNDEDVTVPF 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 41/214 (19%)
ALD2NP_013893.1 ALDH_ALD2-YMR170C 14..502 CDD:143462 42/220 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.