DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and Aldh3b3

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_082821.2 Gene:Aldh3b3 / 73458 MGIID:1920708 Length:479 Species:Mus musculus


Alignment Length:252 Identity:52/252 - (20%)
Similarity:88/252 - (34%) Gaps:82/252 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 MILCEDGDINCALHYLVESLHD-PFACN---AVATLFLQESILEEFVDRIRDRLEPLSTDIS--- 161
            :||||: :::.||..|...:.| |.:.|   .::|.|:              |.||....:.   
Mouse    77 IILCEN-EVDLALKNLQTWMKDEPVSTNLLTKLSTAFI--------------RKEPFGLVLIIAP 126

  Fly   162 -GHPVYIMTLERIGHLQAKR-IVGNPKTVPENASPMLVYDLSHRYL--------ADGP--TGVIT 214
             .:||.:|.:..:|.:.|.. :|..|..:.:|...:|. :|..:||        ..||  ||.:.
Mouse   127 WNYPVNLMIIPLVGAIAAGNCVVLKPSEISKNTEKVLA-ELLPQYLDQSCFAVMLGGPEETGQLL 190

  Fly   215 LHTFR-------------TMKEA--------VELQAKEP---------------------LNFTS 237
            .|.|.             .|..|        :||..|.|                     .|...
Mouse   191 EHKFDYIFFTGSPRVGKIVMTAAAKHLTPITLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQ 255

  Fly   238 VCIWNEKLAAAYELVARLSPLIFTINCYYVNLNEITLPFVCNFNSAKIIDGYHYESL 294
            .|:..:.:..:.|:..:|.|.:......:...|..|.|     |..:||:..|::.|
Mouse   256 TCVAPDYILCSQEMQEQLVPALQNAITRFYGDNPQTSP-----NLGRIINQKHFKRL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 52/252 (21%)
Aldh3b3NP_082821.2 ALDH_F3AB 18..460 CDD:143450 52/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.