Sequence 1: | NP_731094.3 | Gene: | CG2336 / 40804 | FlyBaseID: | FBgn0037455 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_082821.2 | Gene: | Aldh3b3 / 73458 | MGIID: | 1920708 | Length: | 479 | Species: | Mus musculus |
Alignment Length: | 252 | Identity: | 52/252 - (20%) |
---|---|---|---|
Similarity: | 88/252 - (34%) | Gaps: | 82/252 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 MILCEDGDINCALHYLVESLHD-PFACN---AVATLFLQESILEEFVDRIRDRLEPLSTDIS--- 161
Fly 162 -GHPVYIMTLERIGHLQAKR-IVGNPKTVPENASPMLVYDLSHRYL--------ADGP--TGVIT 214
Fly 215 LHTFR-------------TMKEA--------VELQAKEP---------------------LNFTS 237
Fly 238 VCIWNEKLAAAYELVARLSPLIFTINCYYVNLNEITLPFVCNFNSAKIIDGYHYESL 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2336 | NP_731094.3 | DUF1487 | 97..311 | CDD:254173 | 52/252 (21%) |
Aldh3b3 | NP_082821.2 | ALDH_F3AB | 18..460 | CDD:143450 | 52/252 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1012 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |