DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and aldh16a1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001039089.1 Gene:aldh16a1 / 733905 XenbaseID:XB-GENE-5726619 Length:829 Species:Xenopus tropicalis


Alignment Length:235 Identity:52/235 - (22%)
Similarity:98/235 - (41%) Gaps:40/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SPRLMILCEDGDINCALHYLVESL--HDPFACNAVATLFLQESILEEFVDRIRDRLEPL------ 156
            ||  .|:.:..|::.|:..:|:::  :....|:|.:.|.:||||.|:.:.|::.|:..|      
 Frog   280 SP--FIVFDTSDLDSAVEGIVDAIWFNQGQVCSAGSRLLMQESIAEDLIRRLKQRMSHLRLGDSL 342

  Fly   157 --STDISG--HPVYIMTLER-IGHLQAK--RIVGNPKTVPENA---SPMLV--YDLSHRYLAD-- 207
              :.|:..  ......|:|. :...||:  .:..:|..:|:..   .|.|:  .:.:.|.:.:  
 Frog   343 DKAIDVGALVDETQKKTIEEFVEEAQAEGADVFQSPGPIPKKGLFYPPTLITGVNTTSRCVREEI 407

  Fly   208 -GPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTINCYYVNLNE 271
             ||  |:...||||.|||:.|....|... :..:|.|.|..|.|:...:......:|.:.:    
 Frog   408 FGP--VLVAMTFRTAKEAIALGNNTPYGL-AASVWTENLPLALEVAISIKAGTVWVNGHNM---- 465

  Fly   272 ITLPFVCNFNSAKIIDGYHYESLTFKGKRKVVVHPVGTIW 311
                    |::|....||........|.::.:...|...|
 Frog   466 --------FDAAAGFGGYKESGFGRDGGKEGLYEYVRPSW 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 51/233 (22%)
aldh16a1NP_001039089.1 ALDH_F16 21..500 CDD:143429 52/235 (22%)
ALDH-SF 572..>788 CDD:299846
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.