DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and Aldh1l1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_071992.2 Gene:Aldh1l1 / 64392 RGDID:621294 Length:902 Species:Rattus norvegicus


Alignment Length:270 Identity:60/270 - (22%)
Similarity:100/270 - (37%) Gaps:69/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NRPTAISLEEEVQYI-----YKYPLL-----PTPLIDYGFIYNLVCNKPRDVSVPLILEIETEFK 59
            ||...::.:|.|...     :.|||:     ....:..|   |.|..||..|: ||......|..
  Rat   553 NRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAG---NTVVIKPAQVT-PLTALKFAELT 613

  Fly    60 SKDSAPEKPKKV---------PRLSYH------------------SRSSSMSEDEPEPEVQVKYQ 97
            .|...|:....:         .|||.|                  .:|.::|..:   :|.::..
  Rat   614 LKAGIPKGVVNILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKSCALSNVK---KVSLELG 675

  Fly    98 WNSPRLMILCEDGDINCALHYLVESL--HDPFACNAVATLFLQESILEEFVDRIRDRLE------ 154
            ..||  :|:..|.|:|.|:...:.|:  :....|.|...||::|||..:||.::.:.:|      
  Rat   676 GKSP--LIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEESIHNQFVQKVVEEVEKMKIGN 738

  Fly   155 PLSTDIS----GHPVYIMTLERI---GHLQAKRIVGNPKTVPENA---SPMLVYDL-SHRYLAD- 207
            ||..|.:    .|..::..|...   |..:...:|.....||...   .|.:..|: .|.|:|. 
  Rat   739 PLERDTNHGPQNHEAHLRKLVEYCQRGVKEGATLVCGGNQVPRPGFFFQPTVFTDVEDHMYIAKE 803

  Fly   208 ---GPTGVIT 214
               ||..:|:
  Rat   804 ESFGPIMIIS 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 35/141 (25%)
Aldh1l1NP_071992.2 GART 1..203
Substrate binding. /evidence=ECO:0000250 88..90
Aldehyde dehydrogenase 417..902 60/270 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.