DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and Aldh9a1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_071609.2 Gene:Aldh9a1 / 64040 RGDID:68409 Length:497 Species:Rattus norvegicus


Alignment Length:182 Identity:43/182 - (23%)
Similarity:71/182 - (39%) Gaps:47/182 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CNAVATLFLQESILEEF---VDRIRDRL---EPLSTDISGHPVYIMTLERIGHLQAKRIVGNPKT 187
            ||. ..:|:|:.|.:.|   |.|...|:   :||..|....|     |....||:  |::|..::
  Rat   289 CNG-TRVFVQKEIADAFTKEVVRQTQRIKIGDPLLEDTRMGP-----LINAPHLE--RVLGFVRS 345

  Fly   188 VPENASPMLV----Y-----DLSHRYLAD-------------------GPTGVITLHTFRTMKEA 224
            ..|..:.:|.    |     .|.|.|...                   ||  |:::.||.|..|.
  Rat   346 AKEQGATVLCGGEPYAPEDPKLKHGYYMTPCILTNCTDDMTCVKEEIFGP--VMSILTFETEAEV 408

  Fly   225 VELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTINCYYVNLNEITLPF 276
            :| :|.:.....:..::...:..|:.:.|.|......||.|  |::.:.|||
  Rat   409 LE-RANDTTFGLAAGVFTRDIQRAHRVAAELQAGTCYINNY--NVSPVELPF 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 43/182 (24%)
Aldh9a1NP_071609.2 ALDH_F9_TMBADH 31..488 CDD:143409 43/182 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.