DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and CG12516

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_651615.2 Gene:CG12516 / 43370 FlyBaseID:FBgn0039577 Length:300 Species:Drosophila melanogaster


Alignment Length:261 Identity:110/261 - (42%)
Similarity:170/261 - (65%) Gaps:13/261 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EIETEFKSKDSAPEKPKKVPRLSYHSRSSSMSEDEPEPEVQVKYQWNSPRLMILCEDGDINCALH 117
            |:|...:..::..|..|:|..:|          :||:.| :|||.||:|.:|::.||||:|||||
  Fly    49 EVEDNTEKSEAVSESEKEVIEVS----------EEPKEE-EVKYAWNAPCMMVIFEDGDVNCALH 102

  Fly   118 YLVESLHDPFACNAVATLFLQESILEEFVDRIRDRLEPLSTDISGHPVYIMTLERIGHLQAKRIV 182
            :|||||.||||.:|||.:.:||::.||..:|::..::||...::.||.|..||.:|..|:.|.|:
  Fly   103 HLVESLQDPFALDAVAVILVQEALAEEIENRVKILMKPLDARVANHPCYKRTLMKIDELRPKTII 167

  Fly   183 GNPKTVPENASPMLVYDLSHRYLADGPTGVITLHTFRTMKEAVELQAKE-PLNFTSVCIWNEKLA 246
            |....|..:|:|::|.|:.|::|.|||||:||:|.|||..||.::..|| ||...||.||||:::
  Fly   168 GPSDRVLPDATPIMVRDIPHKFLGDGPTGIITMHIFRTPFEATQIYRKEYPLPIASVSIWNERVS 232

  Fly   247 AAYELVARLSPL-IFTINCYYVNLNEITLPFVCNFNSAKIIDGYHYESLTFKGKRKVVVHPVGTI 310
            :.|:::..::.| .|.|||:.|::..|...|.....||.|..|||||:|...|:||::::|||||
  Fly   233 SVYDVIGMMNLLDTFKINCFTVDMEPIKRAFELRKYSACIHRGYHYETLPINGERKIIIYPVGTI 297

  Fly   311 W 311
            :
  Fly   298 F 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 97/215 (45%)
CG12516NP_651615.2 DUF1487 82..298 CDD:254173 97/215 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457910
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.