DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and Ssadh

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001014665.1 Gene:Ssadh / 43092 FlyBaseID:FBgn0039349 Length:509 Species:Drosophila melanogaster


Alignment Length:194 Identity:45/194 - (23%)
Similarity:84/194 - (43%) Gaps:39/194 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NSPRLMILCEDGDINCALHYLVESLHDPF-----ACNAVATLFLQESILEEFVDRIRDRLEPLST 158
            |:|  .|:.:..||..|:...:.|   .|     .|.:....|:|:|:.::||.:::.|:|.|..
  Fly   281 NAP--FIVFDSADIEKAVDGAMAS---KFRNCGQTCVSANRFFVQDSVYDKFVGQLKKRVEALKI 340

  Fly   159 -DISGHPVYIMTLERIGHLQAKRIVG--------------NPKTVPENAS----PMLVYDL---S 201
             |..|..|.|..|  |..:|..::.|              ..:.:|:..|    |.:|.|:   :
  Fly   341 GDGQGCDVQIGPL--INEMQFNKVSGFVEDARSKKANIILGGQPLPDKGSLFYAPTIVTDVPPSA 403

  Fly   202 HRYLAD--GPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTIN 263
            ..|..:  ||  |:::..||..:|||: :|.:.....:...::|.|...:.:..||...:..:|
  Fly   404 QLYSEEVFGP--VVSIIRFRDEEEAVK-KANDTRRGLAGYFYSENLQQVFRVAKRLEVGMVGVN 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 45/194 (23%)
SsadhNP_001014665.1 ALDH_F5_SSADH_GabD 49..503 CDD:143421 45/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.