DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and CG6661

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_648686.3 Gene:CG6661 / 39556 FlyBaseID:FBgn0036403 Length:581 Species:Drosophila melanogaster


Alignment Length:341 Identity:73/341 - (21%)
Similarity:114/341 - (33%) Gaps:101/341 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NRPTAISLEEEVQYIYKYPLLPTPLIDYGFIYNL----VCNKPRDVSVPLI-------LEIETEF 58
            :|...:.:...:|.|...||....:|....:|.:    || .|..:...|.       .:||...
  Fly    64 HRNQRVLVNHAIQEIQHRPLEVPTIIGDDTVYTMDTQRVC-CPHHLQTNLAHVYYANRKQIEAAI 127

  Fly    59 KSKDSAPEKPKKVP---RLSYHSRSSSMSEDEPEPEVQVKYQWNSPRLMILCEDGDINCALHYLV 120
            ||..||......||   ||:...|::::.|   |.|::::                         
  Fly   128 KSALSAQGTWSLVPIAQRLAIWRRAATIIE---EDELRLR------------------------- 164

  Fly   121 ESLHDPFACNAVATLFLQESILEEFVDRIRDRLEPLSTDISGHPVYIMTLERIGHLQAKRIVGNP 185
                          :||..::.:...|..|| :..|.|.:..:..|   ||.:..|:.: |.|:.
  Fly   165 --------------VFLMMTLSKTADDATRD-IRRLLTSLRANADY---LEHLSELRFE-IQGDM 210

  Fly   186 KTVPE-NASPMLVYDLSHRYLADGPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAY 249
            ...|. :..||           ||  .|..|..|.::..:..| |..|....:..:||..|.   
  Fly   211 NVFPSFHLRPM-----------DG--FVAALAPFESVALSSSL-ALCPALMGNTVLWNPSLE--- 258

  Fly   250 ELVARLSPLIFTINCYYVNLNEITLPF-VCNFNSAK-------IIDGYHYESLTFKGKRKVVVHP 306
              ||.:|.|||..      ..|..||. |.||..|.       |.|..|:..|..:.......|.
  Fly   259 --VAPVSYLIFRA------FQEAGLPSGVINFVPANERLFLDTITDAVHFAGLNTQASAAFYRHV 315

  Fly   307 VGTIWAKLAREALVQY 322
                 .||..:.:.:|
  Fly   316 -----HKLVSDRMERY 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 45/222 (20%)
CG6661NP_648686.3 ALDH-SF 68..567 CDD:299846 72/337 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.