DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and aldh2.1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_956784.1 Gene:aldh2.1 / 393462 ZFINID:ZDB-GENE-040426-1262 Length:516 Species:Danio rerio


Alignment Length:215 Identity:45/215 - (20%)
Similarity:84/215 - (39%) Gaps:44/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VQVKYQWNSPRLMILCEDGDINCALHYLVESLHDPF------ACNAVATLFLQESILEEFVDRIR 150
            |.::....||.:::    .|.|  :...||..|...      .|.|....|:||||.:|||:|  
Zfish   281 VSLELGGKSPNIIL----SDAN--MEEAVEQAHSALFFNQGQCCCAGTRTFVQESIYDEFVER-- 337

  Fly   151 DRLEPLSTDISGHPVYIMTLE--RIGHLQAKRIVGNPKTVPENASPMLV---------YDLSHRY 204
             .:|.....|.|.|..:.|.:  ::...|.|:::|...:.....:.::.         |.:....
Zfish   338 -SVERAKNRIVGDPFDLNTEQGPQVDEDQFKKVLGYISSGKREGAKLMCGGAPAAERGYFIQPTV 401

  Fly   205 LAD-------------GPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLS 256
            ..|             ||  |:.:..|::::|.:| :|.:.....:..::.:.:..|..:...|.
Zfish   402 FGDVKDDMTIAREEIFGP--VMQILKFKSLEEVIE-RANDSKYGLAAAVFTQNIDKANYISHGLR 463

  Fly   257 PLIFTINCYYVNLNEITLPF 276
            .....||||  |:..:..||
Zfish   464 AGTVWINCY--NVFGVQAPF 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 44/210 (21%)
aldh2.1NP_956784.1 ALDH_F1AB_F2_RALDH1 30..510 CDD:143459 45/215 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.