DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and CG13539

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001286759.1 Gene:CG13539 / 37680 FlyBaseID:FBgn0034833 Length:260 Species:Drosophila melanogaster


Alignment Length:238 Identity:71/238 - (29%)
Similarity:116/238 - (48%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 PEVQVKYQWNSPRLMILCEDGDINCALHYLVESLHDPFACNAVATLFLQESILEEFVDRIRDRLE 154
            ||......|..||:|:|...||::..:..:|..:..|.....||::.::|||.:|.:.|||..|:
  Fly    30 PEDGSHKSWILPRMMVLFASGDMDQVIEAIVSDMIHPIGTGLVASVLVEESIRDEMIKRIRANLK 94

  Fly   155 PLSTDISGHPVYIMTLERIG-------HLQ-----------AKRIVGNPKTVPENASPMLVYDLS 201
            |:|..|..||.|:.|::.|.       |::           .:|:.|         ||::|.|..
  Fly    95 PMSERIQHHPNYLKTVKLIDRMNCSTIHIEEFEESDTKKRYGRRMKG---------SPLIVLDFP 150

  Fly   202 HRYLADGPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLI--FTINC 264
            ..|....||.::|:.|||.|.|.|:|.::|.|||..:.:|:.|||..::|:.|: |.:  :|.||
  Fly   151 QFYFGGKPTAIMTMSTFRNMNEVVKLHSREGLNFDCITVWSAKLAQCFDLLTRV-PTVDQWTFNC 214

  Fly   265 YYVNLNEITLPFVCNFNSAKIIDGYHYESLTFKGKRKVVVHPV 307
            ...::....|| .....:..|:...|||.....||.|.:..|:
  Fly   215 TKESIKVPKLP-AQPTTTVIIVKNIHYEVHVIGGKIKTIAFPI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 69/231 (30%)
CG13539NP_001286759.1 DUF1487 37..260 CDD:254173 69/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457907
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.