DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and Aldh16a1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001028878.1 Gene:Aldh16a1 / 361571 RGDID:1566295 Length:802 Species:Rattus norvegicus


Alignment Length:315 Identity:65/315 - (20%)
Similarity:122/315 - (38%) Gaps:66/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PLLPTPLI---------DYGFIYNLVCNKPRDVSVPLILEIETEFKSKDSAPEKPKKVPRLSYHS 78
            |..||||:         .:..|.|:||. |..:...|..:...:..:...|.|:.:.: |.:...
  Rat   202 PSFPTPLLLAQLAGELGSFPGILNVVCG-PVSLGPVLASQPGVQKVAFCGAVEEGRAL-RQTLAG 264

  Fly    79 RSSSMSEDEPEPEVQVKYQWNSPRLMILCEDGDINCALHYLVESLHDPFACNAVATLFLQESILE 143
            |.:::.           ....:..|::|.:..|::.|:..:|:::....:...: .|.:|||:.:
  Rat   265 RGATLG-----------LALGTESLLLLTDSADVDSAVEGVVDAVWSDRSLGGL-RLLIQESVWD 317

  Fly   144 EFVDRIRDRLEPL--------STDISGHPVYIMTLERIGHLQAKRIVGNPKT----------VPE 190
            |.:.|::.|:..:        :.|:.........|       |:..|...::          :|.
  Rat   318 EAMKRLQARMAQIRSGKGLDGAVDMGARGAAARDL-------AQSFVDEAQSQGGQVFQAGDMPS 375

  Fly   191 NA---SPMLVYDL---SHRYLADGPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAY 249
            |:   ||.||..|   :....|:.|..|:....|||:|||:.|....|.. .|..:|:|:|..|.
  Rat   376 NSPFFSPTLVSGLPPAAPCAQAEVPWPVVMASPFRTVKEALALANGTPRG-GSASVWSERLGQAL 439

  Fly   250 ELVARLSPLIFTINCYYVNLNEITLPFVCNFNSAKIIDGYH------YESLTFKG 298
            ||...|.     :...::|.:.:..|.|......:....:|      ||.|...|
  Rat   440 ELGYGLQ-----VGTVWINAHGLRDPAVPTGGCKESGSSWHGGPDGLYEYLQLLG 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 50/232 (22%)
Aldh16a1NP_001028878.1 ALDH-SF 19..491 CDD:416387 65/315 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 513..554
ALDH-SF 550..>765 CDD:416387
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.