DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and CG11634

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001286129.1 Gene:CG11634 / 35434 FlyBaseID:FBgn0032968 Length:298 Species:Drosophila melanogaster


Alignment Length:212 Identity:91/212 - (42%)
Similarity:128/212 - (60%) Gaps:3/212 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NSPRLMILCEDGDINCALHYLVESLHDPFACNAVATLFLQESILEEFVDRIRDRLEPLSTDISGH 163
            :||:|||:.|:||||.|||:::||:|:|||.||||.:.::|.|..|.|:||..:|.|||..::.|
  Fly    66 SSPQLMIIFEEGDINSALHFIIESVHNPFASNAVAMVLVEEKIRGEIVERILSKLHPLSKFVAEH 130

  Fly   164 PVYIMTLERIGHLQAKRIVGN--PKTVPENASPMLVYDLSHRYLADGPTGVITLHTFRTMKEAVE 226
            |.|:..||:. |.....|:..  .:..|..|||:.|.|.:|..|...||||:|.||||..:||:.
  Fly   131 PSYLAALEKC-HTSNFNIIRACISEVAPPMASPIFVCDCTHDKLGSYPTGVVTFHTFRNNQEAIA 194

  Fly   227 LQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTINCYYVNLNEITLPFVCNFNSAKIIDGYHY 291
            :...|.|.|.||.||||.|...|:|||.||...|.:||..|:|:.|..|.....|...:.:|:|:
  Fly   195 ISQCESLAFASVSIWNETLTGCYDLVAALSSSYFFLNCANVDLSPILKPHKAQKNYVVVENGFHF 259

  Fly   292 ESLTFKGKRKVVVHPVG 308
            |:|......|.:|.|:|
  Fly   260 ETLRIYDNFKAIVFPIG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 91/212 (43%)
CG11634NP_001286129.1 DUF1487 64..279 CDD:254173 91/212 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457902
Domainoid 1 1.000 69 1.000 Domainoid score I16590
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21644
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.