DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and CG8665

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_610107.1 Gene:CG8665 / 35407 FlyBaseID:FBgn0032945 Length:913 Species:Drosophila melanogaster


Alignment Length:68 Identity:20/68 - (29%)
Similarity:37/68 - (54%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SPRLMILCEDGDINCALHYLVESL--HDPFACNAVATLFLQESILEEFVDRIRDRLEPLSTDISG 162
            ||  :|:..|.|::.|:.:.:.|:  :....|.|...||:::.|.:||:.|:   |:.|.|...|
  Fly   688 SP--LIIFADCDMDKAVKHGMSSVFFNKGENCIAAGRLFVEDRIHDEFIRRV---LKDLRTMTIG 747

  Fly   163 HPV 165
            .|:
  Fly   748 DPL 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 20/68 (29%)
CG8665NP_610107.1 Fmt 4..315 CDD:223301
FMT_core 5..207 CDD:294280
FDH_Hydrolase_C 212..316 CDD:187731
PP-binding 338..403 CDD:278949
PLN02466 396..909 CDD:215259 20/68 (29%)
ALDH_F1L_FTFDH 428..913 CDD:143458 20/68 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.