powered by:
Protein Alignment CG2336 and CG8665
DIOPT Version :9
Sequence 1: | NP_731094.3 |
Gene: | CG2336 / 40804 |
FlyBaseID: | FBgn0037455 |
Length: | 322 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_610107.1 |
Gene: | CG8665 / 35407 |
FlyBaseID: | FBgn0032945 |
Length: | 913 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 20/68 - (29%) |
Similarity: | 37/68 - (54%) |
Gaps: | 7/68 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 SPRLMILCEDGDINCALHYLVESL--HDPFACNAVATLFLQESILEEFVDRIRDRLEPLSTDISG 162
|| :|:..|.|::.|:.:.:.|: :....|.|...||:::.|.:||:.|: |:.|.|...|
Fly 688 SP--LIIFADCDMDKAVKHGMSSVFFNKGENCIAAGRLFVEDRIHDEFIRRV---LKDLRTMTIG 747
Fly 163 HPV 165
.|:
Fly 748 DPL 750
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1012 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.