DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and CG8665

DIOPT Version :10

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_610107.1 Gene:CG8665 / 35407 FlyBaseID:FBgn0032945 Length:913 Species:Drosophila melanogaster


Alignment Length:68 Identity:20/68 - (29%)
Similarity:37/68 - (54%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SPRLMILCEDGDINCALHYLVESL--HDPFACNAVATLFLQESILEEFVDRIRDRLEPLSTDISG 162
            ||  :|:..|.|::.|:.:.:.|:  :....|.|...||:::.|.:||:.|:   |:.|.|...|
  Fly   688 SP--LIIFADCDMDKAVKHGMSSVFFNKGENCIAAGRLFVEDRIHDEFIRRV---LKDLRTMTIG 747

  Fly   163 HPV 165
            .|:
  Fly   748 DPL 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 20/68 (29%)
CG8665NP_610107.1 FMT_core 5..207 CDD:444886
FDH_Hydrolase_C 212..316 CDD:187731
PP-binding 336..394 CDD:425746
ALDH_F1L_FTFDH 428..913 CDD:143458 20/68 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.