DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and P5CDh2

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster


Alignment Length:291 Identity:60/291 - (20%)
Similarity:100/291 - (34%) Gaps:98/291 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EEEVQYIYKYPLLPTPLIDYGFIYNLVCNKPRDVSVPLILEIETEFKSKDSAPEKPKKVPRLSYH 77
            :|:.|.:..|. :..|:..||..:.::.....|.||      |.:.|.     :|.:...|:...
  Fly    94 KEDFQQVLPYD-IQQPIAHYGHAHRVLIQMAIDKSV------EAQVKW-----DKVRLSDRIDIW 146

  Fly    78 SRSSSMSEDEPEPEVQVKYQWNSPRLMILCEDGDINCALHYLVESLHDPFACNAVATLFLQESIL 142
            .|::.:        :..:|::|.....:|.:...:..| ...|..|.|....|.|   ||:|  |
  Fly   147 ERAAML--------IAGRYRYNIIAATMLGQGKTLRQA-EMDVAELVDFMRINPV---FLRE--L 197

  Fly   143 EEFVDRIRD---------RLEPLS-----------TDISGHPVYIMTLERIGHLQAKRIVGNPKT 187
            ..: :.|||         ||..||           |.|:.:..|...|           :||...
  Fly   198 ANY-EPIRDIQNNCRNSMRLRGLSGFVAAISPFNFTGIAANLAYTPAL-----------MGNSVI 250

  Fly   188 VPENASPMLVYDLSHRYLADGPTGVITLHTFRTMKEA------VELQAKEPLNFTSVCIWNEKLA 246
            ...:.|.:    ||:.::            |:.::||      |.....|...|.||...:.|||
  Fly   251 WKPSDSAI----LSNYFV------------FKALREAGVPDGVVNFVPAEETTFASVVTQHPKLA 299

  Fly   247 ------------AAYELVARLSPLIFTINCY 265
                        ..::|||:      .||.|
  Fly   300 GINFTGTSTVLKVLWQLVAQ------NINFY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 45/207 (22%)
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 60/291 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.