DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and aldh3a2a

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_997814.1 Gene:aldh3a2a / 323653 ZFINID:ZDB-GENE-040718-74 Length:488 Species:Danio rerio


Alignment Length:355 Identity:69/355 - (19%)
Similarity:127/355 - (35%) Gaps:82/355 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YKYPLLPT--PLIDYGFIYNLVCNKPRDVS---------VPLILEIETEFKSKDSAPEKPKKVPR 73
            :.||:..|  ||:......|.|..||.:||         :.|.|:.|.........||..:.:.:
Zfish   114 WNYPIAVTLQPLVGAIAAGNAVVVKPSEVSSHTASVMELMSLYLDSEMYQVVTGGVPETQELLKQ 178

  Fly    74 L---SYHSRSSSMSEDEPE------PEVQVKYQWNSPRLMILCEDGDINCALHYLV--ESLHDPF 127
            .   .:::.:|::.:...|      ..|.::....||  ..:.::.||..|...:.  :.|:...
Zfish   179 RFDHIFYTGNSTVGKLVMEAASHHLTPVTLELGGKSP--CYIDKNCDIRIACRRITWGKYLNCGQ 241

  Fly   128 ACNAVATLFLQESILEEFVDRIRDRLEPLSTDISGHPVYIMTLERIGHL----QAKRIV----GN 184
            .|.|...:..:.||.:..:|.|:..::...|      :...|.|..|.:    ..|||:    |:
Zfish   242 TCIAPDYILCESSIQDRVIDEIQKCIKEFYT------IDPKTFEDYGRIINRRHFKRIMALLEGS 300

  Fly   185 PKTVPENASPMLVYDLSHRYLAD------------------GPTGVITLHTFRTMKEAVEL--QA 229
            ...:..:.      |.|..|:|.                  ||  ::.:.|...:|||:|.  ..
Zfish   301 TVAIGGDC------DESECYIAPTVLRDVKPASKVMQEEIFGP--ILPIVTVNGLKEAIEFINDR 357

  Fly   230 KEPLNFTSVCIWNEKLAAAYELVARLSPLIFTINCYYVNLNEITLPFVCNFNSAKIIDGYHYESL 294
            ::||   ::.:::.......::::..|......|...|:.....|||          .|..|...
Zfish   358 EKPL---ALYVFSSSKKVIKQMISETSSGALLANDCMVHFTLSDLPF----------GGVGYSGT 409

  Fly   295 -TFKGKRKV--VVHPVGTIWAKLAREALVQ 321
             .:.||...  |.|....:..||..||:.|
Zfish   410 GRYHGKYSFDQVSHLRSCLIKKLNMEAVNQ 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 45/246 (18%)
aldh3a2aNP_997814.1 ALDH_F3AB 5..446 CDD:143450 69/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.