DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and Aldh3b1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001006999.1 Gene:Aldh3b1 / 309147 RGDID:1359546 Length:468 Species:Rattus norvegicus


Alignment Length:261 Identity:53/261 - (20%)
Similarity:80/261 - (30%) Gaps:82/261 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KPKKVPRLSYHSRSSSMSEDEPEPEVQVKYQWNSPRLMILCEDGDINCALHYLVESLHDPFACNA 131
            |.:||.:.......|:....||...|.:...||.|          :|..|..||.::   .|.|.
  Rat    83 KDEKVSKNLATQLDSAFIRKEPFGLVLIIVPWNYP----------LNLTLVPLVGAI---AAGNC 134

  Fly   132 VATLFLQESILEEFVDRIRDRLEPLSTDISGHPVYIMTLERIGHLQAKRI----------VG--- 183
            |.   |:.|.:.:..::|...:.|...|.|...|.:...:..|.|...|.          ||   
  Rat   135 VV---LKPSEISKATEKILAEVLPRYLDQSCFAVVLGGPQETGQLLEHRFDYIFFTGNTYVGKIV 196

  Fly   184 ------------------NPKTVPENASPMLVYD--LSHRYLADGPTGVITLHTFRTMKEAVELQ 228
                              ||..|.:|..|..|.:  ...||...|.|                  
  Rat   197 MAAAAKHLTPITLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQT------------------ 243

  Fly   229 AKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTINCYYVNLNEITLPFVCNFNSAKIIDGYHYES 293
                      |:..:.:..:.|:..||.|.:......:...|..|.|     |..:||:..|:|.
  Rat   244 ----------CVAPDYVLCSQEMQERLVPALQNAITRFYGDNPQTSP-----NLGRIINQKHFER 293

  Fly   294 L 294
            |
  Rat   294 L 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 46/231 (20%)
Aldh3b1NP_001006999.1 ALDH_F3AB 5..447 CDD:143450 53/261 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.