DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and aldh3b1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_775328.2 Gene:aldh3b1 / 282559 ZFINID:ZDB-GENE-021120-3 Length:473 Species:Danio rerio


Alignment Length:293 Identity:62/293 - (21%)
Similarity:108/293 - (36%) Gaps:109/293 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LMILCEDGDINCALHYLVESLHDPFA------------------CNAVATL--FLQESIL-EEFV 146
            :|.|.||.:..     ::|:||:..|                  |..::.|  ::|.|.: ....
Zfish    33 MMSLFEDNETQ-----ILEALHEDLAKPKFETVLSEIDIVVNDICYNISNLQTWMQPSYVGTNLA 92

  Fly   147 DRIRD---RLEPLSTDIS----GHPVYIMTLERIGHLQAKRIVGN-----PKTVPENASPMLVYD 199
            .::.|   |.|||...:.    .:|:.::....||.:.|    ||     |..: ..|:..|:.:
Zfish    93 TKLDDCFVRREPLGVVLIIGAWNYPIQLILSPLIGAIAA----GNCAILKPSEI-SKATEKLLAE 152

  Fly   200 LSHRYLADGPTGVI--------TL------HTFRTMKEAVE---LQAKEPLNFTSV--------- 238
            |..:||:.....|:        ||      |.|.|..::|.   ||| ..::.|.|         
Zfish   153 LIPKYLSQECYAVVCGGAEETKTLLENRFDHIFYTGSQSVARCVLQA-AAVHLTPVTLELGGKCP 216

  Fly   239 CIWNEKL---AAAYELV---------ARLSPLIFTINCYYV----NLNEITLPFVCN-----FNS 282
            |:...:|   |||..||         :.::|       .||    .:.::.|||:..     :.|
Zfish   217 CLIYGRLDMKAAAKRLVWAKFFNSGQSCVAP-------DYVLCTDEVKDMLLPFMKEALESFYGS 274

  Fly   283 --------AKIIDGYHYESLTFKGKR---KVVV 304
                    .:|:...|::.|....||   |:|:
Zfish   275 EPQESPDYGRIVTDRHWDRLIELMKRSEGKIVI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 62/293 (21%)
aldh3b1NP_775328.2 ALDH_F3AB 5..449 CDD:143450 62/293 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.