DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and Aldh3a1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_114178.1 Gene:Aldh3a1 / 25375 RGDID:2088 Length:453 Species:Rattus norvegicus


Alignment Length:344 Identity:71/344 - (20%)
Similarity:129/344 - (37%) Gaps:88/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 YKYPLLPTPLIDYGFIYNLVCNKPRDVS----------VPLILEIETEFKSKDSAPEK----PKK 70
            |.:.|...|::......|.|..||.:||          :|..::.......|...||.    .::
  Rat   116 YPFNLTIQPMVGAVAAGNAVILKPSEVSGHMADLLATLIPQYMDQNLYLVVKGGVPETTELLKER 180

  Fly    71 VPRLSYHSRSS------SMSEDEPEPEVQVKYQWNSPRLMILC---EDGDINCALHYLV--ESLH 124
            ...:.|...::      :.:.....| |.::....||     |   :|.|::.|...:.  :.::
  Rat   181 FDHIMYTGSTAVGKIVMAAAAKHLTP-VTLELGGKSP-----CYVDKDCDLDVACRRIAWGKFMN 239

  Fly   125 DPFACNAVATLFLQESILEEFVDRIRDRLEPL-------STDISGHPVYIMTLERIGHLQAKRIV 182
            ....|.|...:....||..:.|::::..|:..       |.|. |..:.....:|:     |.::
  Rat   240 SGQTCVAPDYILCDPSIQNQIVEKLKKSLKDFYGEDAKQSRDY-GRIINDRHFQRV-----KGLI 298

  Fly   183 GNPKTVPENASPMLVYDLSHRYLAD------------------GPTGVITLHTFRTMKEAVEL-- 227
            .|.|.....     .:|.|.||:|.                  ||  |:.:...|:::||::.  
  Rat   299 DNQKVAHGG-----TWDQSSRYIAPTILVDVDPQSPVMQEEIFGP--VMPIVCVRSLEEAIQFIN 356

  Fly   228 QAKEPLN---FTSVCIWNEKLAAAYELVARLSPLIFTINCYYVNLNEITLPFVCNFNSAKIIDGY 289
            |.::||.   |::    |||:..  :::|..|....|.|...|::...||||....||.  :..|
  Rat   357 QREKPLALYVFSN----NEKVIK--KMIAETSSGGVTANDVIVHITVPTLPFGGVGNSG--MGAY 413

  Fly   290 H----YESLTFKGKRKVVV 304
            |    :|  ||..:|..:|
  Rat   414 HGKKSFE--TFSHRRSCLV 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 55/247 (22%)
Aldh3a1NP_114178.1 ALDH_F3AB 5..447 CDD:143450 71/344 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.