DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and ALDH1B1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_000683.3 Gene:ALDH1B1 / 219 HGNCID:407 Length:517 Species:Homo sapiens


Alignment Length:134 Identity:32/134 - (23%)
Similarity:50/134 - (37%) Gaps:45/134 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SPRLMILCEDGDINCALHYLVESLHDPF------ACNAVATLFLQESILEEFVDRIRDRLEPLST 158
            ||.:::  .|.|    :.:.||..|:..      .|.|.:..|::|||..||::|          
Human   290 SPSIVL--ADAD----MEHAVEQCHEALFFNMGQCCCAGSRTFVEESIYNEFLER---------- 338

  Fly   159 DISGHPVYIMTLERIGHLQAKRIVGNPKTVPENASPMLVYDLSHRYLADGPTGVITLHTFRTMKE 223
                      |:|:    ..:|.||||..:.....|.:..:...|.|     |.|.|    ..||
Human   339 ----------TVEK----AKQRKVGNPFELDTQQGPQVDKEQFERVL-----GYIQL----GQKE 380

  Fly   224 AVEL 227
            ..:|
Human   381 GAKL 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 32/134 (24%)
ALDH1B1NP_000683.3 ALDH_F1AB_F2_RALDH1 31..511 CDD:143459 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.