DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and Aldh1l2

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_705771.2 Gene:Aldh1l2 / 216188 MGIID:2444680 Length:923 Species:Mus musculus


Alignment Length:345 Identity:64/345 - (18%)
Similarity:103/345 - (29%) Gaps:165/345 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PTAISLEEEVQYIYKYP-------------------------------LLPTPLID---YG-FIY 36
            |.|::.|::...::|:|                               .:|..:||   :| .||
Mouse    63 PLALAAEKDGTPVFKFPRWRLKGKTIKEVAEAYQSVGAELNVLPFCTQFIPMDVIDSPKHGSIIY 127

  Fly    37 N-----------------LVCNKPRDVSV----------PLILEIETEFKSKDSA---------P 65
            :                 ::.:|....||          |::|:...:.|..|:.         |
Mouse   128 HPSLLPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVKPNDTVDSLYNRFLFP 192

  Fly    66 EKPK------------KVPRLSYHSRSSSMSEDEPEPEVQVKYQ-----------WNSPRLMILC 107
            |..|            |.||             .|:||....|:           |:.|      
Mouse   193 EGIKAMVEAVQLIADGKAPR-------------TPQPEEGATYEGIQKKENAEVSWDQP------ 238

  Fly   108 EDGDINCALHYLVESLHD--PFA---CNAVATLFLQESILEEFVDRIRDRLEPLSTDISGHPVYI 167
            .:|     ||..:.. ||  |.|   .|.....|...|:|...|.             ||.|:.|
Mouse   239 AEG-----LHNWIRG-HDKVPGAWAEINGQMVTFYGSSLLTSSVP-------------SGEPLDI 284

  Fly   168 MTLERIGHLQAKRIV--GNPKTVPENASPMLVYDL---------SHRYLADGPTGVITLHTFRTM 221
            ...::.|.:....:|  ||      :...::|.:|         :.:|.:.|.|.|:.|      
Mouse   285 RGAKKPGLVTKNGLVLFGN------DGKALMVRNLQFEDGKMIPASQYFSAGETSVVEL------ 337

  Fly   222 KEAVELQAKEPLNFTSVCIW 241
             .|.||:..|    |...||
Mouse   338 -TAEELKVAE----TIKVIW 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 36/172 (21%)
Aldh1l2NP_705771.2 Fmt 22..326 CDD:223301 52/306 (17%)
FMT_core_FDH_N 23..225 CDD:187716 28/174 (16%)
GART 23..225 28/174 (16%)
FDH_Hydrolase_C 228..327 CDD:187731 24/129 (19%)
PP-binding 346..410 CDD:278949 4/11 (36%)
ALDH_F1L_FTFDH 438..923 CDD:143458
Aldehyde dehydrogenase 438..923
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.