DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and ALDH1A1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_000680.2 Gene:ALDH1A1 / 216 HGNCID:402 Length:501 Species:Homo sapiens


Alignment Length:256 Identity:52/256 - (20%)
Similarity:87/256 - (33%) Gaps:92/256 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 ILCEDGDINCALHYLVESL--HDPFACNAVATLFLQESILEEFVDRIRDRLEPLSTDISGHPVYI 167
            |:..|.|::.|:.:....:  |....|.|.:.:|::|||.:|||.|..:|.:             
Human   277 IVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAK------------- 328

  Fly   168 MTLERIGHLQAKRIVGNPKTVPENASPML-------VYDL--------SHRYLADGPTG------ 211
                       |.|:|||.|......|.:       :.||        :......||.|      
Human   329 -----------KYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFV 382

  Fly   212 ---VITLHT--FRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFT---------- 261
               |.:..|  .|..||.:....::.:.|.|:   ::.:..|......||..:||          
Human   383 QPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSL---DDVIKRANNTFYGLSAGVFTKDIDKAITIS 444

  Fly   262 ---------INCYYVNLNEITLPFVCNFNSAKIID--------GYH----YESLTFKGKRK 301
                     :|||.|      :...|.|...|:..        |:|    .:::|.|..:|
Human   445 SALQAGTVWVNCYGV------VSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQK 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 52/256 (20%)
ALDH1A1NP_000680.2 ALDH_F1AB_F2_RALDH1 15..495 CDD:143459 50/250 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.