DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and alh-2

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_503467.2 Gene:alh-2 / 187001 WormBaseID:WBGene00000108 Length:514 Species:Caenorhabditis elegans


Alignment Length:265 Identity:47/265 - (17%)
Similarity:100/265 - (37%) Gaps:55/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IYNLVCNKPRDVSVPLILEIETEFKSKDSAPEKPKKVPRLSYHSRSSSMSEDEPEPEVQVKYQWN 99
            :.|::..:..|....:...::.:..:...:.|..|.:.:.:..|...         :|.::....
 Worm   231 VVNIIPGRGTDAGEAIASHMDVDKVAFTGSTEVGKTIMKAAAESNVK---------KVTLELGGK 286

  Fly   100 SPRLMILCEDGDINCALHYLVESLHDPF-----ACNAVATLFLQESILEEFVDRIRDRLE----- 154
            ||.  |:..|.|:..|:.   :|.|..|     .|:|.:..|::..|.:|||.:.::.:|     
 Worm   287 SPN--IVFADADLEEAVR---QSHHALFFNQGQCCSAGSRTFVEGKIYDEFVAKAKELVEKTVIG 346

  Fly   155 -PLSTDISGHP-----------VYIMTLERIGHLQAKRIVGNPK----------TVPENASPMLV 197
             |...:.:..|           .||.:.::.|   |:.:.|..|          |:..|.:..:.
 Worm   347 DPFDENTTQGPQIDESQVETIMKYIESGKKEG---AQLVTGGVKHGDQGYFVKPTIFANVNDQMK 408

  Fly   198 YDLSHRYLADGPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTI 262
            ......:   ||  |:.:..|.:|:|.:| :|...:...:..:....|..|.::...:......:
 Worm   409 IAQEEIF---GP--VMIVIRFDSMEELIE-KANNTIYGLAAGVVTNDLNKALQVANTIRAGSVWV 467

  Fly   263 NCYYV 267
            |||.|
 Worm   468 NCYDV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 41/203 (20%)
alh-2NP_503467.2 ALDH_F1-2_Ald2-like 34..507 CDD:143410 47/265 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.