DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and alh-10

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_509203.1 Gene:alh-10 / 180979 WormBaseID:WBGene00000116 Length:506 Species:Caenorhabditis elegans


Alignment Length:209 Identity:49/209 - (23%)
Similarity:79/209 - (37%) Gaps:50/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CNAVATLFLQESILEEFVDRIRDRLEPLSTDISGHPVYIMTLERIGHLQAK-------------- 179
            |...:.||:|:.|   |.|.::..:|.......|.|.   |..:||.:.:|              
 Worm   306 CLCTSRLFVQKPI---FADFVKSYVEEAKKFTVGDPT---TQVQIGAMNSKVHYEKVKSYIELAK 364

  Fly   180 -----RIVGNPKTVP---ENA---SPMLVYDL--SHRYLAD---GPTGVITLHTFRTMKEAVELQ 228
                 .:.|...|:.   ||.   :|.::..|  :.:.:.|   ||  |:.:..|.|.:|.:|..
 Worm   365 KEGADILCGGVTTIQNGCENGYFITPTVIVGLHDASKVMTDEIFGP--VVCITPFDTAEEVIERA 427

  Fly   229 AKEPLNFTSVCIW----NEKLAAAYELVARLSPLIFTINCYYVNLNEITLPFVCNFNSAKIIDGY 289
            ...|... |..:|    :|.|..|.||.|.      |:.|......::::||.....|....:|.
 Worm   428 NSTPYGL-SATVWSSDSDELLNTANELRAG------TVWCNTWLARDLSMPFGGCKQSGNGREGL 485

  Fly   290 HYESLTFKGKRKVV 303
            | :||.|....|.|
 Worm   486 H-DSLHFYSDAKTV 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 49/209 (23%)
alh-10NP_509203.1 ALDH_F8_HMSADH 45..500 CDD:143412 49/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.