DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and alh-3

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_502054.2 Gene:alh-3 / 177999 WormBaseID:WBGene00000109 Length:908 Species:Caenorhabditis elegans


Alignment Length:114 Identity:23/114 - (20%)
Similarity:45/114 - (39%) Gaps:29/114 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EVQVKYQWNSPRLMILCEDGDINCALHYLVESLHDPFACNAV-----------ATLFLQESILEE 144
            :|.::....||  :|:..|.|:..|:..         ||.||           ..:|:.:||.::
 Worm   675 KVSLELGGKSP--LIIFADADLEKAVKQ---------ACGAVFFNKGENCIAAGRVFIAKSIHDD 728

  Fly   145 FVDRIRDRL------EPLSTDISGHPV-YIMTLERIGHLQAKRIVGNPK 186
            ||.::.:..      :||....:..|. ::..|.::.....|.:.|..|
 Worm   729 FVKKLVEEAKQYQIGDPLDRSTAHGPQNHLAHLNKLVEYVEKAVAGGAK 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 22/108 (20%)
alh-3NP_502054.2 fmt 1..318 CDD:273088
FMT_core_FDH_N 1..209 CDD:187716
FDH_Hydrolase_C 214..315 CDD:187731
PP-binding 335..393 CDD:278949
ALDH-SF 423..908 CDD:299846 23/114 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.