DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and alh-3

DIOPT Version :10

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_502054.2 Gene:alh-3 / 177999 WormBaseID:WBGene00000109 Length:908 Species:Caenorhabditis elegans


Alignment Length:114 Identity:23/114 - (20%)
Similarity:45/114 - (39%) Gaps:29/114 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EVQVKYQWNSPRLMILCEDGDINCALHYLVESLHDPFACNAV-----------ATLFLQESILEE 144
            :|.::....||  :|:..|.|:..|:..         ||.||           ..:|:.:||.::
 Worm   675 KVSLELGGKSP--LIIFADADLEKAVKQ---------ACGAVFFNKGENCIAAGRVFIAKSIHDD 728

  Fly   145 FVDRIRDRL------EPLSTDISGHPV-YIMTLERIGHLQAKRIVGNPK 186
            ||.::.:..      :||....:..|. ::..|.::.....|.:.|..|
 Worm   729 FVKKLVEEAKQYQIGDPLDRSTAHGPQNHLAHLNKLVEYVEKAVAGGAK 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 22/108 (20%)
alh-3NP_502054.2 FMT_core_FDH_N 1..209 CDD:187716
FDH_Hydrolase_C 214..315 CDD:187731
PP-binding 335..393 CDD:425746
ALDH-SF 423..908 CDD:448367 23/114 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.