DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and ALDH16A1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_699160.2 Gene:ALDH16A1 / 126133 HGNCID:28114 Length:802 Species:Homo sapiens


Alignment Length:242 Identity:52/242 - (21%)
Similarity:93/242 - (38%) Gaps:64/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LMILCEDGDINCALHYLVESLHDPFACNAVATLFLQESILEEFVDRIRDRLEPL--------STD 159
            |::|.:..|::.|:..:|::.........: .|.:|||:.:|.:.|:::|:..|        :.|
Human   278 LLLLTDTADVDSAVEGVVDAAWSDRGPGGL-RLLIQESVWDEAMRRLQERMGRLRSGRGLDGAVD 341

  Fly   160 ISGHPV----YIMTLERIGHLQAKRI--VGN--------PKTVPEN---ASPMLVYDLSHRYLAD 207
            :.....    .:....|....|..::  .|:        |.|:..|   |||....::       
Human   342 MGARGAAACDLVQRFVREAQSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVEV------- 399

  Fly   208 GPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTINCYYVNLNEI 272
             |..|:....|||.|||: |.|.......|..:|:|:|..|.||...|.     :...::|.:.:
Human   400 -PWPVVVASPFRTAKEAL-LVANGTPRGGSASVWSERLGQALELGYGLQ-----VGTVWINAHGL 457

  Fly   273 TLPFV---------CNFNSAKIIDG-YHYESLTFKGKRKVVVHPVGT 309
            ..|.|         |:::...  || |.|            :.|.||
Human   458 RDPSVPTGGCKESGCSWHGGP--DGLYEY------------LRPSGT 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 52/242 (21%)
ALDH16A1NP_699160.2 ALDH-SF 19..492 CDD:299846 52/242 (21%)
ALDH-SF 527..>765 CDD:299846
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.