DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and Aldh2

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_033786.1 Gene:Aldh2 / 11669 MGIID:99600 Length:519 Species:Mus musculus


Alignment Length:200 Identity:49/200 - (24%)
Similarity:83/200 - (41%) Gaps:46/200 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SPRLMILCEDGDINCALHYLVESLHDPFA--------CNAVATLFLQESILEEFVDRIRDRLEPL 156
            ||.  |:..|.|::.|    ||..|  ||        |.|.:..|:||::.:|||:|...|.:  
Mouse   292 SPN--IIMSDADMDWA----VEQAH--FALFFNQGQCCCAGSRTFVQENVYDEFVERSVARAK-- 346

  Fly   157 STDISGHPVYIMTLE--RIGHLQAKRIVGNPKTVPENASPMLV---------YDLSHRYLAD--- 207
             :.:.|:|....|.:  ::...|.|:|:|..|:..:..:.:|.         |.:......|   
Mouse   347 -SRVVGNPFDSRTEQGPQVDETQFKKILGYIKSGQQEGAKLLCGGGAAADRGYFIQPTVFGDVKD 410

  Fly   208 ----------GPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLIFTI 262
                      ||  |:.:..|:|::|.|. :|.:.....:..::.:.|..|..|...|......|
Mouse   411 GMTIAKEEIFGP--VMQILKFKTIEEVVG-RANDSKYGLAAAVFTKDLDKANYLSQALQAGTVWI 472

  Fly   263 NCYYV 267
            |||.|
Mouse   473 NCYDV 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 48/199 (24%)
Aldh2NP_033786.1 PLN02466 3..518 CDD:215259 48/199 (24%)
ALDH_F1AB_F2_RALDH1 33..513 CDD:143459 48/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.