DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and ALDH1L1

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001257293.1 Gene:ALDH1L1 / 10840 HGNCID:3978 Length:912 Species:Homo sapiens


Alignment Length:270 Identity:61/270 - (22%)
Similarity:100/270 - (37%) Gaps:69/270 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NRPTAISLEEEVQYI-----YKYPLL-----PTPLIDYGFIYNLVCNKPRDVSVPLILEIETEFK 59
            ||...::.:|.|...     :.|||:     ....:..|   |.|..||..|: ||......|..
Human   563 NRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAG---NTVVIKPAQVT-PLTALKFAELT 623

  Fly    60 SKDSAPEKPKKV---------PRLSYH------------------SRSSSMSEDEPEPEVQVKYQ 97
            .|...|:....|         .|||.|                  .:|.::|..:   :|.::..
Human   624 LKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKSCAISNVK---KVSLELG 685

  Fly    98 WNSPRLMILCEDGDINCALHYLVESL--HDPFACNAVATLFLQESILEEFVDRIRDRL------E 154
            ..||  :|:..|.|:|.|:...:.|:  :....|.|...||:::||.:|||.|:.:.:      .
Human   686 GKSP--LIIFADCDLNKAVQMGMSSVFFNKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMKVGN 748

  Fly   155 PLSTDIS-------GHPVYIMTLERIGHLQAKRIVGNPKTVPENA---SPMLVYDL-SHRYLAD- 207
            ||..|..       .|.|.:|...:.|..:...:|.....||...   .|.:..|: .|.::|. 
Human   749 PLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGATLVCGGNQVPRPGFFFEPTVFTDVEDHMFIAKE 813

  Fly   208 ---GPTGVIT 214
               ||..:|:
Human   814 ESFGPVMIIS 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 35/141 (25%)
ALDH1L1NP_001257293.1 Fmt 10..319 CDD:223301
FMT_core_FDH_N 11..213 CDD:187716
FDH_Hydrolase_C 216..316 CDD:187731
PP-binding 335..401 CDD:278949
ALDH_F1L_FTFDH 427..912 CDD:143458 61/270 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.