DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and Aldh1l1

DIOPT Version :10

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_081682.1 Gene:Aldh1l1 / 107747 MGIID:1340024 Length:902 Species:Mus musculus


Alignment Length:125 Identity:25/125 - (20%)
Similarity:38/125 - (30%) Gaps:50/125 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DLVLLYEGSCCSARYCNMFEQPVCS-------------EG-------QMYQ-TVCEFEERQCIEF 103
            |||..|...||......:.::.:||             ||       :::. |:|.|..|..   
Mouse   126 DLVGPYCMRCCKGNVEGIVDRKLCSGLGLQAESRGGGNEGTGEDGSLKLHSCTLCGFTSRYT--- 187

  Fly   104 KLFKNHISMDSSQEKCSCTAPCPTEWNPVCDKKG------QTH-----------ANFCTF 146
            ...|.|:...:.::...|         |:|....      |.|           .|.|||
Mouse   188 NHVKRHMKTHNGEKPYGC---------PLCSYASAQLVNLQRHLRIHTGEKPYKCNTCTF 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 12/67 (18%)
Aldh1l1NP_081682.1 Hydrolase domain. /evidence=ECO:0000250|UniProtKB:P28037 1..310 25/125 (20%)
FMT_core_FDH_N 1..203 CDD:187716 16/79 (20%)
FDH_Hydrolase_C 206..306 CDD:187731 8/33 (24%)
AcpA <309..399 CDD:442659
ALDH_F1L_FTFDH 417..902 CDD:143458
Aldehyde dehydrogenase domain. /evidence=ECO:0000250|UniProtKB:P28037 417..902
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.