DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2336 and aldh1l2

DIOPT Version :9

Sequence 1:NP_731094.3 Gene:CG2336 / 40804 FlyBaseID:FBgn0037455 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002661418.2 Gene:aldh1l2 / 100333269 ZFINID:ZDB-GENE-100426-6 Length:923 Species:Danio rerio


Alignment Length:212 Identity:48/212 - (22%)
Similarity:90/212 - (42%) Gaps:34/212 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 EVQVKYQWNSPRLMILCEDGDINCALHYLVESLHDPF----ACNAVATLFLQESILEEFVDRIRD 151
            :|.::....||  :|:..|.|::.|:...:.|::  |    .|.|...||::|||.:|::.|:.:
Zfish   690 KVSLELGGKSP--LIIFSDCDMDKAVRMGMSSVY--FNKGENCIAAGRLFVEESIHDEYIRRVVE 750

  Fly   152 RL------EPL--STD--ISGHPVYIMTLE---RIGHLQAKRIVGNPKTVPENA---SPMLVYDL 200
            .:      :||  |||  ...|..::..|.   .||..:...:|...:.|....   .|.:..|:
Zfish   751 EIKKMKIGDPLDRSTDHGPQNHKAHMDKLVEYCEIGVKEGATLVYGGRQVDRPGFFMEPTVFTDV 815

  Fly   201 -SHRYLAD----GPTGVITLHTFRTMK-EAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPLI 259
             .|.::|.    ||  |:.:..|:... :.|..:|.:.....:..::...:..|..:..||....
Zfish   816 EDHMFIAKEESFGP--VMVVSKFKDGDVDGVLSRANDTEFGLASGVFTRDINKAMYVSERLEAGT 878

  Fly   260 FTINCYYVNLNEITLPF 276
            ..||.|  |..::..||
Zfish   879 VFINTY--NKTDVAAPF 893

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2336NP_731094.3 DUF1487 97..311 CDD:254173 47/206 (23%)
aldh1l2XP_002661418.2 Fmt 22..323 CDD:223301
FMT_core_FDH_N 23..225 CDD:187716
FDH_Hydrolase_C 228..327 CDD:187731
PP-binding 346..412 CDD:278949
ALDH_F1L_FTFDH 438..923 CDD:143458 48/212 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.