DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1137 and Iqcd

DIOPT Version :9

Sequence 1:NP_649665.2 Gene:CG1137 / 40803 FlyBaseID:FBgn0037454 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_083684.1 Gene:Iqcd / 75732 MGIID:1922982 Length:458 Species:Mus musculus


Alignment Length:444 Identity:95/444 - (21%)
Similarity:181/444 - (40%) Gaps:111/444 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MRGKSMPAEKKNDIKLAQHEFATVRIVQIGCVLNVLAEAIERVKISLIMPKLLEHPAHMAKILNG 71
            :|...:|||....:..::.:..|:...:|   ::||.|||.::::..:|..:..||    :.|..
Mouse    22 LRTGLVPAEPMKTLVPSKSKLNTIEAKRI---MSVLDEAIHKIELITLMSYMESHP----EALED 79

  Fly    72 TKYEKAVHLVESFVRRREFILREKRPPLMDHG--IIQIIDFFQRNSRIYLLFPSYYNHMSDNEKK 134
            |       |.|.|||    .|||.    :|.|  :::.....||..:  .|........:.|:::
Mouse    80 T-------LPEDFVR----ALREH----LDIGQTLVERASILQRRHK--KLEEEEEAEETRNQER 127

  Fly   135 LLNAFEMLYDLAKDRL------YRTSTDAIAQ----ERQLHAMYKQN--------EVVKEQVEEL 181
            ||:     .:|.|..|      :|.||..:.:    |.|...:.:..        :.:.:.:.||
Mouse   128 LLS-----LELHKVNLLTLAHQFRDSTKTVLRLVLGEPQFTRLLQVQAPGRSPGAQCLLDGLVEL 187

  Fly   182 R----KKILDQKAAIRKSLADKEAYLQNYEDLLMKKKREKNERIQKEIDRCTRLVKANKKLSLER 242
            |    :|:|.....:|    :|..::|:     :.::.|:|:.:..::......|..||:..:|:
Mouse   188 RGFLFEKLLTSPMEVR----EKNQFIQD-----ISRRSERNQEVIDDLQAELANVLKNKESEVEK 243

  Fly   243 Q--------------------------ADLEEQ-----------LQKTRNN--------YNLTTK 262
            :                          .:.|:|           |.||:.:        :||..:
Mouse   244 ENFVIQELKNHLHQVFKFSENSLLRTKQEAEKQQKVDFRASQVRLAKTQQDILALRAQYHNLVME 308

  Fly   263 NYLKQEKVFREEKNKLILQLQAIIKKYDHSIGEKMIENMELAEEHKKAKKALDEYMIGFLKVERV 327
            | .:.|:..|::|.|:..:::..|:|||..:|||..|..:|...||:.|..|:|.......:...
Mouse   309 N-REAEQALRKKKYKVETEIENWIQKYDMEMGEKQDEYEDLESIHKEEKLQLEELRERHAVLVEE 372

  Fly   328 YKQIVVKREEEEARHRQHRVLLFAMNRAAIKIQKYWRKW--KKHMR-KKNRRNK 378
            :.||..:.|....:..:....:..|.|||..||..|:.:  :..:| ||.:|.|
Mouse   373 FSQIRAESEINSKKRVEAEREMVRMVRAATLIQAVWKGYLVRSILRSKKKKRGK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1137NP_649665.2 Smc <161..>375 CDD:224117 55/273 (20%)
IqcdNP_083684.1 Smc <201..>394 CDD:224117 38/202 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..458 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56817
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31598
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.100

Return to query results.
Submit another query.