DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1137 and iqcd

DIOPT Version :9

Sequence 1:NP_649665.2 Gene:CG1137 / 40803 FlyBaseID:FBgn0037454 Length:379 Species:Drosophila melanogaster
Sequence 2:XP_021332131.1 Gene:iqcd / 553445 ZFINID:ZDB-GENE-060526-200 Length:427 Species:Danio rerio


Alignment Length:387 Identity:82/387 - (21%)
Similarity:172/387 - (44%) Gaps:66/387 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VLNVLAEAIERVKISLIMPKLLEHPAHMAKILNGTKYEKAVHLVESFVRRREFILREKRPPLM-- 100
            :|.||.|.|.:::.:.::|.||:    .::.|:.:..|:.|..::...:     |.||...:.  
Zfish    61 ILGVLDECIHQMETASLLPTLLK----SSEALSLSLEEEVVKALKEHQK-----LEEKYQSIALD 116

  Fly   101 ---DHGIIQ---------IIDFFQRNSRIYLLFPS---YYNHMSDN------EKKLLNAFEMLYD 144
               |...:|         :.|.|::..|:....|:   ....:..|      .:|:.|....|.:
Zfish   117 GNHDQNELQVEKAKSAKLVQDSFRKIIRLLRATPTTKVVLKRIEPNTTGEMGSQKIRNGLCELRE 181

  Fly   145 LAKDRLYRTSTDAIAQERQLHAMYKQNEVVKEQVEELRKKILDQKAAIRKSLADKEAYLQNYEDL 209
            :..:||..|..:.....:.:..:.:::...::.:|.|.|::.:..       .:|:|.:....:.
Zfish   182 VVLERLLTTPAEEKESRKMMLEVSQRHSANQKLIEALEKEVAEAN-------KNKDAEISTLNNK 239

  Fly   210 LMKKKREKNE----------RIQKEIDRCTRLVKANKKLSLERQADLEEQLQKTRNNYNLTTKNY 264
            :::.:|..::          |.|::.::.:.   :::|.|..::|.|:::..:.|...|...|..
Zfish   240 VLQLRRTLHQMGKGLEEFVMRTQQDAEKQSH---SDRKTSDGKRARLQQEASQLRTQLNNAIKAS 301

  Fly   265 LKQEKVFREEKNKLILQLQAIIKKYDHSIGEKMIENMELAEEHKKAKKALDEYMIGFLKVERVYK 329
            ..:|:..|:||.|...:::.:|:|||..||||..|..|:...|::.:..|.|....|..::..|.
Zfish   302 RGREQDLRKEKYKEETEIENLIQKYDAEIGEKQTELEEMTRMHEEDQMELTELEKRFDTLDLEYS 366

  Fly   330 QIVVKREE-EEARHRQHRVLLFAMNRAAIKIQKYWR------------KWKKHMRKKNRRNK 378
            ||:.:|:| :|.|.:|.|.... .::||..||.|||            |.||..:.|.::.|
Zfish   367 QIMEERQEAQELREQQERERQI-QSQAATVIQAYWRGFCVRKAKKVSAKPKKGKKGKGKKGK 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1137NP_649665.2 Smc <161..>375 CDD:224117 54/236 (23%)
iqcdXP_021332131.1 DUF3084 169..>401 CDD:331293 54/242 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9118
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5272
OMA 1 1.010 - - QHG56817
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto40108
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31598
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.