DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1137 and IQCD

DIOPT Version :9

Sequence 1:NP_649665.2 Gene:CG1137 / 40803 FlyBaseID:FBgn0037454 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001317381.1 Gene:IQCD / 115811 HGNCID:25168 Length:449 Species:Homo sapiens


Alignment Length:419 Identity:93/419 - (22%)
Similarity:187/419 - (44%) Gaps:73/419 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PAEKKNDIKLAQHEFATVRIVQIGCVLNVLAEAIERVKISLIMPKLLEHPAHMAKILNGTKYEKA 77
            ||:....:.|::.:..|:...:|   :::|.|||.:|::..::..:..:...|..:| |....:|
Human    30 PADPLKPLVLSRTKLTTIEAKRI---MSILDEAIYKVELVTLLSYVASNREDMEGML-GEDVMRA 90

  Fly    78 VH--------LVESF--VRRREFILREKR----------------------PPLMDHGIIQIIDF 110
            |.        |:|:.  ::.:|..|:|::                      .|||.    ||.|.
Human    91 VREHEDLCQVLLENVRCLKEKERQLQEQKEAEEEGWLRDRLLSIELQKSSLSPLMQ----QIKDS 151

  Fly   111 FQRNSRIYLLFPSYYNHM-------SDNEKKLLNAFEMLYDLAKDRLYRTSTDAIAQERQLHAMY 168
            .:...|:.|..|.....:       |...:..:::...|.....::|..:..:|..:.:.|..:.
Human   152 TKNVLRLLLSNPQAARLLQMQTQGRSAEAQNFIDSLIELRGFLFEKLLTSPMEARDKAQFLQDIS 216

  Fly   169 KQNEVVKEQVEELRKKILDQKAAIRKSLADKEAY----LQNYEDLLMKKKREKNERIQKEIDRCT 229
            :||...::.::.|.|: |.::...|.:..:||.:    |:|:...::|.......|.::|.:   
Human   217 RQNSNNQQIIDTLEKE-LAERMKNRNAEVEKENFVIQELKNHLHQVLKFSENSLVRTKQEAE--- 277

  Fly   230 RLVKANKKLSLERQADLEEQ-LQKTRNNYNLTTKNYLKQEKVFREEKNKLILQLQAIIKKYDHSI 293
            :..||:.:.|..|.|.:::: ||.....|||..:| .:.|:..|::|.|:..:::..|:|||..:
Human   278 KQQKADFRASQARVAKIQQEILQLQSQFYNLVMEN-REAEQALRKKKYKVETEIENWIQKYDTEM 341

  Fly   294 GEKMIENMELAEEHKKAKKALDEYMIGFLKVERVYKQIVVK----REEEEARHRQHRVL---LFA 351
            |||..|..:|...|::.|.:|:|       :.|.:|.:|.:    |||.|...::....   :..
Human   342 GEKQEELEDLDAVHREEKISLEE-------LRRRHKVLVGEFAQIREEREINSKKRMEAEQEMVR 399

  Fly   352 MNRAAIKIQKYWRKW--KKHMRKKNRRNK 378
            |.|||..||..|:.:  :..:|.|.:|.|
Human   400 MVRAATLIQALWKGYLVRSLLRSKKKRGK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1137NP_649665.2 Smc <161..>375 CDD:224117 58/227 (26%)
IQCDNP_001317381.1 Smc <212..>396 CDD:224117 49/195 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..449 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56817
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31598
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
44.100

Return to query results.
Submit another query.