DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1137 and iqcd

DIOPT Version :9

Sequence 1:NP_649665.2 Gene:CG1137 / 40803 FlyBaseID:FBgn0037454 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_001135698.2 Gene:iqcd / 100216273 XenbaseID:XB-GENE-960682 Length:434 Species:Xenopus tropicalis


Alignment Length:434 Identity:92/434 - (21%)
Similarity:175/434 - (40%) Gaps:88/434 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLTEMMRGKSMPAEKKNDIKLAQHEFATVRIVQIGCVLNVLAEAIERVKI--------------- 51
            |.|...:.|:..|:.|  ||:.:.....:..::...|::||.|.|:::::               
 Frog    22 SRTTSSQSKTSKAQTK--IKMLEQGRKKLTSIETQRVISVLDETIKKLELVSMFQHAVDNLEQYK 84

  Fly    52 ----SLIMPKLLEHPAHMAKI------LNGTKYEKAVHLVES----------FVRRREFILREKR 96
                |.::..|.||......:      |:..:.|:...:||.          |.|.|:       
 Frog    85 IVLGSELVGALREHQRLQDNMNLQLTRLHSKEGEEEYSIVEDKNTKEQSDVIFARIRQ------- 142

  Fly    97 PPLMDHGIIQIIDFFQRNS-RIYLLFPSYYNHMSDNEKKLLNAFEMLYDLAKDRLYRTS------ 154
                  ||...|    ||: |:::..|.        ..|.|.|...|.|.|...|.:|.      
 Frog   143 ------GIQSSI----RNTLRLFVSNPP--------ASKALRAEGHLRDPAYQELIQTMSEMRGF 189

  Fly   155 ------TDAIAQERQLHAMY-------KQNEVVKEQVEELRKKILDQKAAIRKSLADKEAYLQNY 206
                  |..:.|..::..::       |..|::....|||:..:||:...|.|    |...:::.
 Frog   190 LFEFLLTSPLEQTEKMRYLHDITIRNKKNRELLLTLEEELKTVVLDRDTEISK----KNEIIRHL 250

  Fly   207 EDLLMKKKREKNERIQKEIDRCTRLVKANKKLSLERQADLEEQLQKTRNNYNLTTKNYLKQEKVF 271
            :..|.:.::....::::.:.......|::.:.|..:.:.:..:||:.|:..:.|.....:.|...
 Frog   251 KVNLHQLEKLSESQVKRIMQEAETQQKSDCRTSEGKCSKIHHELQQLRSQLSSTISENREIELTM 315

  Fly   272 REEKNKLILQLQAIIKKYDHSIGEKMIENMELAEEHKKAKKALDEYMIGFLKVERVYKQIVVKRE 336
            |::|.|:..:::..|:|||..:|||..|..||..|:...|..|.|.......:|..|.||:.:|.
 Frog   316 RKKKYKIETEIENWIQKYDTDMGEKQDELEELEAEYNLEKAQLAEVQEKLAVMEEEYIQIMEERR 380

  Fly   337 EEEARHRQHRVLLFAMNRAAIKIQKYWRKW--KKHMRKKNRRNK 378
            ..:.|..:....|...||||..||.:|:.:  ::.|:.|.::.|
 Frog   381 LAKLRMEEEERELANKNRAATVIQAHWKGYLVRQSMKSKKKKKK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1137NP_649665.2 Smc <161..>375 CDD:224117 51/222 (23%)
iqcdNP_001135698.2 IQ 396..417 CDD:197470 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56817
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31598
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9920
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.