DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and CD86

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_787058.5 Gene:CD86 / 942 HGNCID:1705 Length:329 Species:Homo sapiens


Alignment Length:350 Identity:61/350 - (17%)
Similarity:101/350 - (28%) Gaps:157/350 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSV 149
            ||......|::..|.:.|                |.|.|...:.......|.|||:.....|:|:
Human     2 DPQCTMGLSNILFVMAFL----------------LSGAAPLKIQAYFNETADLPCQFANSQNQSL 50

  Fly   150 S-----WIRLRDGHILTVDRAVFIADQRFLAIKQPDKY----------WTLQIKYVQARDAGSYE 199
            |     |   :|...|.::. |::..::|.::.  .||          |||::..:|.:|.|.|:
Human    51 SELVVFW---QDQENLVLNE-VYLGKEKFDSVH--SKYMGRTSFDSDSWTLRLHNLQIKDKGLYQ 109

  Fly   200 C--------------QVSTEPKVSARVQLQVVVPRTEIL-------------GEPD--------- 228
            |              |:::|..|.|......:||.:.|.             |.|:         
Human   110 CIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLR 174

  Fly   229 -------------------------------RYVKAGSNVVLRCIVRG------------ALE-- 248
                                           .:....||:.:.||:..            .||  
Human   175 TKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDP 239

  Fly   249 --PPTFIMWY-----------------------------------HGAEQLAADSRRHRTQLDPN 276
              ||..|.|.                                   :..|:..::..:.|.::  :
Human   240 QPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREKI--H 302

  Fly   277 LPEASGEGQSTIGSLIIESAKKRDT 301
            :||.|.|.|....|....|..|.||
Human   303 IPERSDEAQRVFKSSKTSSCDKSDT 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 26/119 (22%)
Ig strand B 135..139 CDD:409353 2/3 (67%)
Ig strand C 148..152 CDD:409353 2/8 (25%)
Ig strand E 183..187 CDD:409353 3/3 (100%)
Ig strand F 197..202 CDD:409353 2/18 (11%)
IG_like 227..320 CDD:214653 22/165 (13%)
Ig strand B 237..241 CDD:409544 0/3 (0%)
Ig strand C 252..256 CDD:409544 1/3 (33%)
Ig strand E 289..293 CDD:409544 1/3 (33%)
Ig strand G 313..316 CDD:409544
CD86NP_787058.5 IgV_CD86 26..133 CDD:409508 24/112 (21%)
FR1 26..40 CDD:409508 2/13 (15%)
Ig strand A 26..31 CDD:409508 0/4 (0%)
Ig strand B 34..40 CDD:409508 2/5 (40%)
CDR1 41..52 CDD:409508 2/10 (20%)
FR2 53..60 CDD:409508 1/9 (11%)
Ig strand C 53..59 CDD:409508 1/8 (13%)
CDR2 62..82 CDD:409508 3/22 (14%)
Ig strand C' 64..69 CDD:409508 0/5 (0%)
Ig strand C' 72..74 CDD:409508 0/1 (0%)
FR3 83..115 CDD:409508 8/31 (26%)
Ig strand D 85..89 CDD:409508 0/3 (0%)
Ig strand E 93..99 CDD:409508 3/5 (60%)
Ig strand F 106..114 CDD:409508 3/7 (43%)
CDR3 116..118 CDD:409508 0/1 (0%)
FR4 119..133 CDD:409508 2/13 (15%)
Ig strand G 120..133 CDD:409508 2/12 (17%)
Ig 136..221 CDD:472250 9/84 (11%)
Ig strand B 152..157 CDD:409505 0/4 (0%)
Ig strand C 167..172 CDD:409505 0/4 (0%)
Ig strand E 201..205 CDD:409505 0/3 (0%)
Ig strand F 215..220 CDD:409505 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.