| Sequence 1: | NP_788586.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_787058.5 | Gene: | CD86 / 942 | HGNCID: | 1705 | Length: | 329 | Species: | Homo sapiens |
| Alignment Length: | 350 | Identity: | 61/350 - (17%) |
|---|---|---|---|
| Similarity: | 101/350 - (28%) | Gaps: | 157/350 - (44%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 85 DPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSV 149
Fly 150 S-----WIRLRDGHILTVDRAVFIADQRFLAIKQPDKY----------WTLQIKYVQARDAGSYE 199
Fly 200 C--------------QVSTEPKVSARVQLQVVVPRTEIL-------------GEPD--------- 228
Fly 229 -------------------------------RYVKAGSNVVLRCIVRG------------ALE-- 248
Fly 249 --PPTFIMWY-----------------------------------HGAEQLAADSRRHRTQLDPN 276
Fly 277 LPEASGEGQSTIGSLIIESAKKRDT 301 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr11 | NP_788586.1 | Ig | 125..216 | CDD:472250 | 26/119 (22%) |
| Ig strand B | 135..139 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 148..152 | CDD:409353 | 2/8 (25%) | ||
| Ig strand E | 183..187 | CDD:409353 | 3/3 (100%) | ||
| Ig strand F | 197..202 | CDD:409353 | 2/18 (11%) | ||
| IG_like | 227..320 | CDD:214653 | 22/165 (13%) | ||
| Ig strand B | 237..241 | CDD:409544 | 0/3 (0%) | ||
| Ig strand C | 252..256 | CDD:409544 | 1/3 (33%) | ||
| Ig strand E | 289..293 | CDD:409544 | 1/3 (33%) | ||
| Ig strand G | 313..316 | CDD:409544 | |||
| CD86 | NP_787058.5 | IgV_CD86 | 26..133 | CDD:409508 | 24/112 (21%) |
| FR1 | 26..40 | CDD:409508 | 2/13 (15%) | ||
| Ig strand A | 26..31 | CDD:409508 | 0/4 (0%) | ||
| Ig strand B | 34..40 | CDD:409508 | 2/5 (40%) | ||
| CDR1 | 41..52 | CDD:409508 | 2/10 (20%) | ||
| FR2 | 53..60 | CDD:409508 | 1/9 (11%) | ||
| Ig strand C | 53..59 | CDD:409508 | 1/8 (13%) | ||
| CDR2 | 62..82 | CDD:409508 | 3/22 (14%) | ||
| Ig strand C' | 64..69 | CDD:409508 | 0/5 (0%) | ||
| Ig strand C' | 72..74 | CDD:409508 | 0/1 (0%) | ||
| FR3 | 83..115 | CDD:409508 | 8/31 (26%) | ||
| Ig strand D | 85..89 | CDD:409508 | 0/3 (0%) | ||
| Ig strand E | 93..99 | CDD:409508 | 3/5 (60%) | ||
| Ig strand F | 106..114 | CDD:409508 | 3/7 (43%) | ||
| CDR3 | 116..118 | CDD:409508 | 0/1 (0%) | ||
| FR4 | 119..133 | CDD:409508 | 2/13 (15%) | ||
| Ig strand G | 120..133 | CDD:409508 | 2/12 (17%) | ||
| Ig | 136..221 | CDD:472250 | 9/84 (11%) | ||
| Ig strand B | 152..157 | CDD:409505 | 0/4 (0%) | ||
| Ig strand C | 167..172 | CDD:409505 | 0/4 (0%) | ||
| Ig strand E | 201..205 | CDD:409505 | 0/3 (0%) | ||
| Ig strand F | 215..220 | CDD:409505 | 1/4 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||