DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and dpr21

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:237 Identity:96/237 - (40%)
Similarity:138/237 - (58%) Gaps:9/237 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAI--KQP 179
            ||.|..||.|||:.:|...:|.||:|.||||:|||||.||.|:|||..:.:.:||||.:|  ||.
  Fly    51 PYFDTSATKNVTSLVGITGHLNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIYNKQT 115

  Fly   180 DKYWTLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVR 244
            .. |:||||:.|.||:|.|||||||.|.|...:...||.|.|.|||.|:.|:..||.|.|.|:::
  Fly   116 GD-WSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVEPITSILGGPEIYIDLGSTVNLTCVIK 179

  Fly   245 GALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPS 309
            ...:||..:.|.|..:::..||.|....:      .:.:|..|...|:|:.|...|:|.|||.||
  Fly   180 HLPDPPISVQWNHNNQEINYDSPRGGVSV------ITEKGDITTSYLLIQRASIADSGQYTCLPS 238

  Fly   310 NSPSATVTLNIINGESSASAVTSSAATTRAYALSILALLLSV 351
            |:.|.:|.::|:.|:..|:...|....:...:|..|.:.|::
  Fly   239 NANSKSVNVHILKGDHPAAVQKSHLLVSELLSLCFLQICLNL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 48/92 (52%)
Ig 127..217 CDD:299845 47/91 (52%)
IG_like 227..320 CDD:214653 29/92 (32%)
IGc2 234..311 CDD:197706 24/76 (32%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 44/78 (56%)
IG_like 71..140 CDD:214653 41/69 (59%)
IG_like 162..249 CDD:214653 29/92 (32%)
IGc2 169..242 CDD:197706 25/78 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444703
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.990

Return to query results.
Submit another query.