DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and KIRREL3

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:302 Identity:65/302 - (21%)
Similarity:110/302 - (36%) Gaps:63/302 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SSASAASTAISSDESGDPSSATAFSSLAQVSSLLPEASALSATSGLVEPYLDGYATSNVTTQ--- 130
            :|.....|.:......:|.|....::|...:        ||.|       :|.|....:||:   
Human   300 ASGEVYRTTVDYTYFSEPVSCEVTNALGSTN--------LSRT-------VDVYFGPRMTTEPQS 349

  Fly   131 ----IGTHAYLPCRVKQLGNKSVS--WIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKY 189
                :|:.|...|  ...||.|::  |::...|.:|:.::                   ||.:|.
Human   350 LLVDLGSDAIFSC--AWTGNPSLTIVWMKRGSGVVLSNEK-------------------TLTLKS 393

  Fly   190 VQARDAGSYECQVSTEPKVSA---RVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPT 251
            |:..|||.|.|: :..|:|.|   .|.|.|..|.. |.....::...|....::|.:| :..||.
Human   394 VRQEDAGKYVCR-AVVPRVGAGEREVTLTVNGPPI-ISSTQTQHALHGEKGQIKCFIR-STPPPD 455

  Fly   252 FIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGN-YTCSPSNSPSAT 315
            .|.|......|.:.:....|      .|.....:..|.:|.|.:..:.|... |.|:..||..:.
Human   456 RIAWSWKENVLESGTSGRYT------VETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSD 514

  Fly   316 VTLNIINGESSASAVTSSAATTRAYALSILALLLSVILIGVG 357
            .  .||..:...|.:.|.|...   |.|:...::..:.:|.|
Human   515 T--EIIRLKEQGSEMKSGAGLE---AESVPMAVIIGVAVGAG 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 25/102 (25%)
Ig 127..217 CDD:299845 25/101 (25%)
IG_like 227..320 CDD:214653 18/93 (19%)
IGc2 234..311 CDD:197706 16/77 (21%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352
Ig2_KIRREL3-like 171..252 CDD:143236
Ig_2 260..337 CDD:290606 8/51 (16%)
I-set 341..422 CDD:254352 25/102 (25%)
IGc2 355..406 CDD:197706 18/72 (25%)
Ig5_KIRREL3 424..521 CDD:143306 22/106 (21%)
IG_like 432..521 CDD:214653 20/97 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.