DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and KIRREL2

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:216 Identity:56/216 - (25%)
Similarity:81/216 - (37%) Gaps:49/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 IGTHAYLPCRVKQLGNKSVSWIRLRDGHILTVDRAVFIADQRFLAIKQP--DKYW---------- 183
            :|..|.|||.:      ...|     |.:......:.:..||.|    |  .:||          
Human    37 LGEEARLPCAL------GAYW-----GLVQWTKSGLALGGQRDL----PGWSRYWISGNAANGQH 86

  Fly   184 TLQIKYVQARDAGSYECQVSTEPKVSARVQLQVVVP--RTEILGEPDRYVKAGSNVVLRCIVRGA 246
            .|.|:.|:..|..|||||.:.....|...||.|:||  ..::||.|...:.||....|.|..||.
Human    87 DLHIRPVELEDEASYECQATQAGLRSRPAQLHV
LVPPEAPQVLGGPSVSLVAGVPANLTCRSRGD 151

  Fly   247 LEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTI---------GSLIIESAKK---- 298
            ..|...::|:... .|...:..|:|.|....|   |..:||:         |:..:..|:.    
Human   152 ARPTPELLWFRDG-VLLDGATFHQTLLKEGTP---GSVESTLTLTPFSHDDGATFVCRARSQALP 212

  Fly   299 --RDTGNYTCSPSNSPSATVT 317
              |||. .|.|....|..|::
Human   213 TGRDTA-ITLSLQYPPEVTLS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 25/96 (26%)
Ig 127..217 CDD:299845 25/97 (26%)
IG_like 227..320 CDD:214653 26/106 (25%)
IGc2 234..311 CDD:197706 22/91 (24%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 25/96 (26%)
IGc2 38..106 CDD:197706 22/82 (27%)
I-set 126..224 CDD:254352 26/102 (25%)
Ig2_KIRREL3-like 141..223 CDD:143236 20/86 (23%)
Cell attachment site. /evidence=ECO:0000255 149..151 1/1 (100%)
Ig 231..306 CDD:299845 0/2 (0%)
IG_like 234..308 CDD:214653
Ig 312..395 CDD:299845
I-set 317..395 CDD:254352
Ig 397..501 CDD:299845
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.