| Sequence 1: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001018172.1 | Gene: | nitr2a / 795524 | ZFINID: | ZDB-GENE-020225-28 | Length: | 328 | Species: | Danio rerio |
| Alignment Length: | 111 | Identity: | 23/111 - (20%) |
|---|---|---|---|
| Similarity: | 40/111 - (36%) | Gaps: | 21/111 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 100 SLLPEASALSATSGLVEPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDG-HILTVD 163
Fly 164 RAVFIADQRF---------LAIKQPDKYWTLQIKYVQARDAGSYEC 200 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 19/86 (22%) |
| Ig | 127..217 | CDD:299845 | 19/84 (23%) | ||
| IG_like | 227..320 | CDD:214653 | |||
| IGc2 | 234..311 | CDD:197706 | |||
| nitr2a | NP_001018172.1 | IgV | 27..126 | CDD:143167 | 19/83 (23%) |
| IG_like | 28..126 | CDD:214653 | 19/82 (23%) | ||
| Ig | 141..234 | CDD:299845 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1457433at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||