DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and nectin4b

DIOPT Version :10

Sequence 1:NP_788586.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001334985.6 Gene:nectin4b / 794920 ZFINID:ZDB-GENE-070912-114 Length:570 Species:Danio rerio


Alignment Length:227 Identity:54/227 - (23%)
Similarity:83/227 - (36%) Gaps:62/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GTSEGAGTSSASAAS-----------TAISSDESGDPSSATAFSSLAQVSSL------------L 102
            |.|.|...|..:.|.           :..|.:.|||....|...||....|:            :
Zfish   149 GQSYGIAASCRAVAHPPARLSWDTDVSGQSQNRSGDGGVVTTQFSLYPSRSMNGQKLDCLVWHPV 213

  Fly   103 PEASALSATSGLVEPYLDGYATSNVTTQIGTH-AYLPCRVKQLGN---KSVSWIR----LRDGHI 159
            .|.....|...:|:...|..|..:.:.|||:. :.:.|.||  ||   ::|||.|    |..|.:
Zfish   214 YEEPHRLANKLVVQFPPDAEAVGSGSWQIGSSGSEIRCLVK--GNPLPQNVSWSRSDGVLPSGVL 276

  Fly   160 LTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQV-STEPKVSARVQLQVVVPRTEI 223
            :..||.||         .:|          :|..|.|.|.|:. :|.....|...||:...|:| 
Zfish   277 VQKDRLVF---------SRP----------LQQTDEGVYVCRTHNTLGVAKAEFTLQIDAVRSE- 321

  Fly   224 LGEPDRYVKAGSNVVLRCIVRGALEPPTFIMW 255
                  :..:.|:.:|  ||.||......:::
Zfish   322 ------FSISSSHTLL--IVIGAASAGVLVLF 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_788586.1 Ig 125..216 CDD:472250 27/99 (27%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 2/3 (67%)
Ig strand E 183..187 CDD:409353 0/3 (0%)
Ig strand F 197..202 CDD:409353 2/4 (50%)
IG_like 227..320 CDD:214653 6/29 (21%)
Ig strand B 237..241 CDD:409544 1/3 (33%)
Ig strand C 252..256 CDD:409544 0/4 (0%)
Ig strand E 289..293 CDD:409544
Ig strand G 313..316 CDD:409544
nectin4bXP_001334985.6 Ig 34..134 CDD:472250
Ig strand B 37..41 CDD:409471
Ig strand C 53..57 CDD:409471
Ig strand E 98..102 CDD:409471
Ig strand F 112..117 CDD:409471
Ig strand G 126..129 CDD:409471
Ig 146..226 CDD:472250 15/76 (20%)
Ig strand B 154..158 CDD:409501 0/3 (0%)
Ig strand C 167..171 CDD:409501 0/3 (0%)
Ig strand E 190..194 CDD:409501 0/3 (0%)
Ig strand F 204..209 CDD:409501 0/4 (0%)
Ig strand G 219..222 CDD:409501 0/2 (0%)
Ig 248..315 CDD:472250 24/87 (28%)
Ig strand B 248..251 CDD:409390 0/2 (0%)
Ig strand C 261..265 CDD:409390 2/3 (67%)
Ig strand E 281..285 CDD:409390 3/12 (25%)
Ig strand F 295..300 CDD:409390 2/4 (50%)
Ig strand G 308..311 CDD:409390 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.