DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Trav12-3

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_008768928.3 Gene:Trav12-3 / 691058 RGDID:1564212 Length:132 Species:Rattus norvegicus


Alignment Length:128 Identity:27/128 - (21%)
Similarity:48/128 - (37%) Gaps:27/128 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 VQLQVVVPRTEILGEPDRY-VKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDP 275
            :||..|..:.::...|:.. |..|:...|.|....:..  .:..||          |:|      
  Rat    13 LQLNGVSSQQKVQQSPESLTVPEGAKTSLNCTFSSSAS--QYFAWY----------RQH------ 59

  Fly   276 NLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSATVTLNIINGESSASAVTSSAATTR 338
                   .|:.....|.|.|..:::.|.:|.. .|:.|..|.|:|.:.:...||:...|.:|:
  Rat    60 -------PGKEPKELLSIFSTGEKEEGRFTIQ-LNTASLHVFLHIRDSQPGDSALYLCAVSTQ 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 2/3 (67%)
Ig 127..217 CDD:299845 2/4 (50%)
IG_like 227..320 CDD:214653 19/93 (20%)
IGc2 234..311 CDD:197706 13/76 (17%)
Trav12-3XP_008768928.3 Ig 24..118 CDD:416386 24/117 (21%)
FR1 24..46 CDD:409353 5/21 (24%)
Ig strand A 24..26 CDD:409353 0/1 (0%)
Ig strand A' 30..34 CDD:409353 0/3 (0%)
Ig strand B 37..46 CDD:409353 2/8 (25%)
CDR1 46..50 CDD:409353 0/3 (0%)
FR2 51..58 CDD:409353 2/16 (13%)
Ig strand C 52..59 CDD:409353 3/16 (19%)
CDR2 59..78 CDD:409353 5/31 (16%)
Ig strand C' 60..70 CDD:409353 2/9 (22%)
Ig Strand C' 74..78 CDD:409353 0/3 (0%)
FR3 81..113 CDD:409353 9/32 (28%)
Ig strand D 81..86 CDD:409353 1/5 (20%)
Ig strand E 91..97 CDD:409353 2/5 (40%)
Ig strand F 105..112 CDD:409353 2/6 (33%)
CDR3 114..118 CDD:409353 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.