DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and Kirrel3

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:263 Identity:62/263 - (23%)
Similarity:103/263 - (39%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 SALSAT--SGLVEPYLDGYATS---NVTTQIGTHAYLPCRVKQLGNKSVS--WIRLRDGHILTVD 163
            :||.:|  |..|:.|.....||   ::...:|:.|...|  ..:||.|::  |::...|.:|:.:
Mouse   318 NALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSC--AWIGNPSLTIVWMKRGSGVVLSNE 380

  Fly   164 RAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSA---RVQLQVVVPRTEILG 225
            :                   ||.:|.|:..|||.|.|: :..|:|.|   .|.|.|..|.. |..
Mouse   381 K-------------------TLTLKSVRQEDAGKYVCR-AVVPRVGAGEREVTLTVNGPPI-ISS 424

  Fly   226 EPDRYVKAGSNVVLRCIVRGALEPPTFIMWYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGS 290
            ...::...|....::|.:| :..||..|.|......|.:.:....|....|..|      ..|.:
Mouse   425 TQTQHALHGEKGQIKCFIR-STPPPDRIAWSWKENVLESGTSGRYTVETVNTEE------GVIST 482

  Fly   291 LIIESAKKRDTGN-YTCSPSNSPSATVTLNIINGESSASAVTSSAATTRAYALSILALLLSVILI 354
            |.|.:..:.|... |.|:..||..:..  .||..:...|.:.|.|...   |.|:...::..:.:
Mouse   483 LTISNIVRADFQTIYNCTAWNSFGSDT--EIIRLKEQGSEMKSGAGLE---AESVPMAVIIGVAV 542

  Fly   355 GVG 357
            |.|
Mouse   543 GAG 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 24/98 (24%)
Ig 127..217 CDD:299845 23/94 (24%)
IG_like 227..320 CDD:214653 19/93 (20%)
IGc2 234..311 CDD:197706 17/77 (22%)
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353
IgI_2_KIRREL3-like 149..246 CDD:409416
Ig strand B 166..170 CDD:409416
Ig strand C 180..184 CDD:409416
Ig strand E 210..214 CDD:409416
Ig strand F 224..229 CDD:409416
Ig strand G 239..242 CDD:409416
Ig <267..334 CDD:416386 6/15 (40%)
Ig strand B 267..274 CDD:409353
Ig strand C 279..286 CDD:409353
Ig strand C' 288..291 CDD:409353
Ig strand D 298..302 CDD:409353
Ig strand E 304..310 CDD:409353
Ig strand G 321..334 CDD:409353 4/12 (33%)
Ig 335..416 CDD:416386 25/102 (25%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 2/11 (18%)
Ig strand C 365..371 CDD:409353 1/5 (20%)
Ig strand E 381..387 CDD:409353 2/24 (8%)
IgI_5_KIRREL3 418..515 CDD:409479 23/106 (22%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 1/3 (33%)
Ig strand F 496..501 CDD:409479 2/4 (50%)
Ig strand G 509..512 CDD:409479 0/4 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.