DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and nitr4a

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_571729.1 Gene:nitr4a / 60652 ZFINID:ZDB-GENE-001106-11 Length:337 Species:Danio rerio


Alignment Length:279 Identity:65/279 - (23%)
Similarity:96/279 - (34%) Gaps:56/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LVEPYLDGYATSNV-------TTQIGTHAYLPCRVKQLGNKSVSWIR--LRDGHILTVD------ 163
            |..|.:.|.....|       |||.|....|||.:.:.....|.|.:  |.:..::.|.      
Zfish    11 LFHPQVSGKNNCTVDQVDEVLTTQEGHIVLLPCLLLEDNFHRVIWYKQVLGEKPVVIVSSYHHSQ 75

  Fly   164 ----RAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVS--------------- 209
                .:.|...|||.|:::.|.: .|.|:.....|:|:|.|..:....||               
Zfish    76 PNEFSSDFKETQRFHAVRKADSF-NLTIRRTLKSDSGTYFCGSAFTHVVSFGTGTILLVKGADLK 139

  Fly   210 -ARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGAL--EPPTFIMWYHGAEQLAADSRRHRT 271
             |.:||.|           ...:|.||||.|||.|.|..  :....:.|:..:.........:..
Zfish   140 PAVIQLPV-----------HAVIKPGSNVTLRCSVEGKTCDKGVQSVYWFRQSSSTTHQGIVYTH 193

  Fly   272 QLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSNSPSAT----VTLNIING---ESSASA 329
            ....|....|.:.||.:.:|...|....:.|.|.||........    .||.|.:|   ||....
Zfish   194 GKSKNECADSSDTQSCLQNLAKMSVNVSEAGLYYCSVVTCDEVLFGNGTTLVIKDGFISESIQKC 258

  Fly   330 VTSSAATTRAYALSILALL 348
            :........|.:|:|..||
Zfish   259 ILIGLTVLSAVSLTINILL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 29/125 (23%)
Ig 127..217 CDD:299845 29/124 (23%)
IG_like 227..320 CDD:214653 23/98 (23%)
IGc2 234..311 CDD:197706 20/78 (26%)
nitr4aNP_571729.1 Ig 24..134 CDD:299845 26/110 (24%)
IG_like 29..127 CDD:214653 25/98 (26%)
V-set 144..246 CDD:284989 26/112 (23%)
IG_like 146..246 CDD:214653 24/110 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.