DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and nitr3a

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_571727.1 Gene:nitr3a / 60649 ZFINID:ZDB-GENE-001106-8 Length:337 Species:Danio rerio


Alignment Length:260 Identity:50/260 - (19%)
Similarity:97/260 - (37%) Gaps:43/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 VTTQIGTHAYLPCRVKQLGNKSVSWIRLRDG-------------HILTVDRAVFIADQRFLAIKQ 178
            |..::|:...|||........:|||.:...|             ..:|...|....::.|:.|  
Zfish    30 VVAELGSRVTLPCFHSDDYVTTVSWTKHSSGKKPLLIAYSDFNSERVTYQNAFNNTNRFFITI-- 92

  Fly   179 PDKYWTLQIKYVQARDAGSYEC-------QVSTEPKVSARVQLQVVVPRTEILGEP--DRYVKAG 234
            ....:.|.|.:::..|..:|.|       .:..|..:..|.:.. .:..|.::.:|  || :..|
Zfish    93 ASGCYNLTILHLEKEDFANYYCVKDFLNRLMFGEGTILLR
KETD-RISSTSVIQQPVSDR-LHPG 155

  Fly   235 SNVVLRCIVRGALEPPTF-IMWYHGAEQLAADS--RRHRTQLDPNL--PEASGEGQSTIGSLIIE 294
            .:|.|:|.|...:....: :.|:..:...:...  ..|..:.|..|  .|.|...||.:.||...
Zfish   156 DSVTLQCSVSSHICAGHYRVYWFKHSSGYSQPGIIYTHDNRSDQCLKSSEKSSFVQSCVYSLSQT 220

  Fly   295 SAKKRDTGNYTCSPSNSPSATVTLNIIN-GESSASAVTSS----AATTRAYALSILALLLSVILI 354
            .....|.|.|.|       |..|...|: |..:...:.:|    ......:.:|:.:::::::|:
Zfish   221 ELTTSDAGVYYC-------AVDTCGKIHFGNGTKLTIEASFFWNPVAVILFTISVTSIVVNIVLV 278

  Fly   355  354
            Zfish   279  278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 20/108 (19%)
Ig 127..217 CDD:299845 20/109 (18%)
IG_like 227..320 CDD:214653 24/99 (24%)
IGc2 234..311 CDD:197706 19/81 (23%)
nitr3aNP_571727.1 V-set 26..130 CDD:284989 19/101 (19%)
IG_like 27..132 CDD:214653 19/103 (18%)
V-set 145..250 CDD:284989 26/112 (23%)
IG_like 154..250 CDD:214653 23/102 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.