DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and nitr1c

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_938164.2 Gene:nitr1c / 60645 ZFINID:ZDB-GENE-001106-4 Length:328 Species:Danio rerio


Alignment Length:171 Identity:35/171 - (20%)
Similarity:63/171 - (36%) Gaps:25/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 KSVSWIRLRDGHILTVDRAVFIADQRFLAIKQPDKYWTLQIKYVQARDAGSYECQVSTEPKVSAR 211
            |.:.|            .:.|....|| .:.:.|.|:.|.|...:..|:.:|.|.||....:...
Zfish    71 KQLKW------------NSSFEKTNRF-NVTKVDDYFNLTILKTKPSDSATYYCVVSAYETIGMG 122

  Fly   212 VQLQVVVP------RTEILGEPDRYVKAGSNVVLRC-IVRGALEPPTFIMWY---HGAEQLAADS 266
            ...:::|.      .|.:.......|..|.:|.|:| |...:......:.|:   .|..:....:
Zfish   123 SATRLLV
KDAATDRNTTLHQSLIETVDPGDSVNLQCSIFTESCAGDHSVYWFKQSSGHPEGVLYT 187

  Fly   267 RRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCS 307
            :..|.....|..|:  :.||.:.||...:..:.|:|.|.|:
Zfish   188 KGERNGRCKNNTES--QTQSCVYSLHKNNISRSDSGIYYCA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 14/68 (21%)
Ig 127..217 CDD:299845 14/69 (20%)
IG_like 227..320 CDD:214653 19/85 (22%)
IGc2 234..311 CDD:197706 18/78 (23%)
nitr1cNP_938164.2 V-set 23..129 CDD:311561 14/70 (20%)
V-set 147..244 CDD:311561 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.