DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and igsf9bb

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_009293693.1 Gene:igsf9bb / 569554 ZFINID:ZDB-GENE-091112-15 Length:1439 Species:Danio rerio


Alignment Length:266 Identity:68/266 - (25%)
Similarity:94/266 - (35%) Gaps:54/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SSASAASTAISSDESGDPSSATAFSSLAQVSSLLPEASALSATSGLVE--PYLDGYATSNVTTQI 131
            |..|....:||.::.| ..:..|:|.         :..|:..|..||:  |::.. ...|:|..|
Zfish   187 SDGSLTLVSISREDRG-AYTCRAYSE---------QGEAVHTTRLLVQGPPFIVS-PPENITVNI 240

  Fly   132 GTHAYLPCRVKQL-GNKSVSWIRLRDGHILTVD--RAVFIADQRFLAIKQPDKYWTLQIKYVQAR 193
            ...|:..|:.:.. ||.:.:|....|......|  |.|.|.....|.|.|           |:..
Zfish   241 SQDAFFTCQAEAYPGNLTYTWFWEEDNVFFKNDLKRRVSILIDGSLIISQ-----------VKPE 294

  Fly   194 DAGSYECQVSTE----PKVSARVQLQVVVPRTEILGEPDRYVKAGSNVVLRCIVRGALEPPTFIM 254
            |||.|.|..|..    |..||  .|.|..|...|...|..||..|....:||.| .|..|.|.:.
Zfish   295 DAGKYTCSPSNSLGRPPSASA--YLTVHYPARVINMPPVIYVAIGLPGYIRCPV-DANPPVTSVK 356

  Fly   255 WYHGAEQLAADSRRHRTQLDPNLPEASGEGQSTIGSLIIESAKKRDTGNYTCSPSN-------SP 312
            |             .:..|...:.:..|..|...||:.:....:...|.|||.|.|       ||
Zfish   357 W-------------KKDGLPLRIEKYPGWSQMEDGSIRVSEVTEDSLGTYTCVPYNSLGTMGPSP 408

  Fly   313 SATVTL 318
            .|.:.|
Zfish   409 PAPLVL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 27/97 (28%)
Ig 127..217 CDD:299845 26/96 (27%)
IG_like 227..320 CDD:214653 26/99 (26%)
IGc2 234..311 CDD:197706 19/83 (23%)
igsf9bbXP_009293693.1 IG_like 30..113 CDD:214653
Ig 41..113 CDD:143165
IG_like 144..223 CDD:214653 9/45 (20%)
IGc2 151..208 CDD:197706 5/21 (24%)
I-set 227..319 CDD:254352 28/105 (27%)
Ig <263..319 CDD:299845 19/68 (28%)
Ig_2 326..414 CDD:290606 26/101 (26%)
IG_like 329..403 CDD:214653 22/87 (25%)
IG_like 424..504 CDD:214653
Ig 440..504 CDD:299845
FN3 509..604 CDD:238020
FN3 620..704 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.