DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr11 and nitr12

DIOPT Version :9

Sequence 1:NP_001262320.1 Gene:dpr11 / 40800 FlyBaseID:FBgn0053202 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001020667.1 Gene:nitr12 / 557932 ZFINID:ZDB-GENE-041001-1 Length:318 Species:Danio rerio


Alignment Length:297 Identity:58/297 - (19%)
Similarity:89/297 - (29%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SGLV--EPYLDGYATSNVTTQIGTHAYLPCRVKQLGNKSVSWIRLRDGHILTV--------DRAV 166
            ||.|  :..|:.:......|       |.|.:........||.:...|...|.        ...|
Zfish    17 SGAVVQKKVLESFTAGQTVT-------LECLISVNLENYFSWFKQTLGEAPTCIVSLYAESSTPV 74

  Fly   167 FIAD---QRFLAIKQPDKYWTLQIKYVQARDAGSYEC-------------------QVSTEPKVS 209
            |..:   ...:::::....:.|.||..:..|||.|.|                   ..||:   .
Zfish    75 FYGEFKNNHRMSVQKEKNTFVLNIKEAKPSDAGIYYCGARDYDLITFSNGLFLNYKDASTK---Q 136

  Fly   210 ARVQLQVVVPRTEILGEPDRYVKAGSNVVLRC-IVRGALEPPTFIMWYHGAEQLAADSRRHR-TQ 272
            ..::..:..|......||:  ...|.:|.|.| ::....|....|.|:           ||. ..
Zfish   137 HHIKQFLSGPNLGTEHEPE--FNPGDSVNLHCSVLTERCEENHTIYWF-----------RHEFGD 188

  Fly   273 LDPNLPEASG--------EGQSTIGSLIIESAKKR----DTGNYTCSPSNSPSATVTL-NIINGE 324
            ..|.|....|        ..:..:.|.|....||.    |.|.|.|       |..|. .|:.|.
Zfish   189 AHPGLIYKDGNTTDQCEKRSEKDVQSCIYNLPKKNLNLTDAGVYYC-------AVATCGEILFGN 246

  Fly   325 SSASAVTSSA------------ATTRAYALSILALLL 349
            .|...:.:|:            |:|....|.|:.:||
Zfish   247 GSRINIRASSKFSWTDVKVPVLASTNILCLVIIVILL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr11NP_001262320.1 I-set 125..216 CDD:254352 19/120 (16%)
Ig 127..217 CDD:299845 19/119 (16%)
IG_like 227..320 CDD:214653 23/107 (21%)
IGc2 234..311 CDD:197706 20/90 (22%)
nitr12NP_001020667.1 IgV 28..124 CDD:143167 17/102 (17%)
IG_like 30..123 CDD:214653 17/99 (17%)
V-set 150..253 CDD:284989 27/122 (22%)
IG_like 155..236 CDD:214653 20/100 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.